TAF12

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF12
Protein TAF12 PDB 1h3o.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF12, TAF2J, TAFII20, TATA-box binding protein associated factor 12
Зовнішні ІД OMIM: 600773 MGI: 1913714 HomoloGene: 68477 GeneCards: TAF12
Шаблон експресії
PBB GE TAF12 209463 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001135218
NM_005644
NM_025579
RefSeq (білок)
NP_001128690
NP_005635
NP_079855
Локус (UCSC) Хр. 1: 28.59 – 28.64 Mb Хр. 4: 132.27 – 132.3 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF12 (англ. TATA-box binding protein associated factor 12) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 161 амінокислот, а молекулярна маса — 17 924[4].

Послідовність амінокислот
1020304050
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL
SPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAAC
QLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQ
RMALIRKTTKK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hoffmann A., Roeder R.G. (1996). Cloning and characterization of human TAF20/15. Multiple interactions suggest a central role in TFIID complex formation.. J. Biol. Chem. 271: 18194 — 18202.  PubMed DOI:10.1074/jbc.271.30.18194
  • Choi B., Bando M., Hasegawa S., Horikoshi M. (1996). Isolation and characterization of a cDNA encoding a novel human transcription factor TFIID subunit containing similarities with histones H2B and H3.. Gene 169: 263 — 267.  PubMed DOI:10.1016/0378-1119(95)00838-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11545 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q16514 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]