DLX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DLX3
Ідентифікатори
Символи DLX3homeobox protein DLX-3
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

DLX3 (англ. Distal-less homeobox 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 287 амінокислот, а молекулярна маса — 31 738[2].

Послідовність амінокислот
1020304050
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDY
YSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYRE
QPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQK
AQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN
NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNS
WYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

Кодований геном білок за функцією належить до білків розвитку. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Price J.A., Bowden D.W., Wright J.T., Pettenati M.J., Hart T.C. (1998). Identification of a mutation in DLX3 associated with tricho-dento-osseous (TDO) syndrome.. Hum. Mol. Genet. 7: 563 — 569.  PubMed DOI:10.1093/hmg/7.3.563
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2916 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, O60479 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]