SREBF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SREBF1
Protein SREBF1 PDB 1am9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SREBF1, SREBP-1c, SREBP1, bHLHd1, SREBP1a, sterol regulatory element binding transcription factor 1
Зовнішні ІД OMIM: 184756 MGI: 107606 HomoloGene: 3079 GeneCards: SREBF1
Шаблон експресії
PBB GE SREBF1 202308 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001005291
NM_004176
NM_001321096
NM_011480
NM_001313979
NM_001358314
NM_001358315
RefSeq (білок)
NP_001005291
NP_001308025
NP_004167
NP_001300908
NP_035610
NP_001345243
NP_001345244
Локус (UCSC) Хр. 17: 17.81 – 17.84 Mb Хр. 11: 60.2 – 60.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SREBF1 (англ. Sterol regulatory element binding transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 147 амінокислот, а молекулярна маса — 121 675[4].

Послідовність амінокислот
1020304050
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPP
YAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPP
QPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFP
APAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVS
LHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSL
LLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA
EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLV
VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDL
VSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGS
GGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSC
NPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVW
LLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAG
GLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSAL
NLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACL
AQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQ
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAA
GAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASG
YLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGT
SSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP
TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPG
FLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTSS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, метаболізм ліпідів, метаболізм холестеролу, метаболізм стероїдів, метаболізм стеролів, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, мембрані, ендоплазматичному ретикулумі, цитоплазматичних везикулах, апараті гольджі.

Література[ред. | ред. код]

  • Hua X., Wu J., Goldstein J.L., Brown M.S., Hobbs H.H. (1995). Structure of the human gene encoding sterol regulatory element binding protein-1 (SREBF1) and localization of SREBF1 and SREBF2 to chromosomes 17p11.2 and 22q13.. Genomics 25: 667 — 673.  PubMed DOI:10.1016/0888-7543(95)80009-B
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hua X., Sakai J., Brown M.S., Goldstein J.L. (1996). Regulated cleavage of sterol regulatory element binding proteins requires sequences on both sides of the endoplasmic reticulum membrane.. J. Biol. Chem. 271: 10379 — 10384.  PubMed DOI:10.1074/jbc.271.17.10379
  • Parraga A., Bellsolell L., Ferre-D'Amare A.R., Burley S.K. (1998). Co-crystal structure of sterol regulatory element binding protein 1a at 2.3-A resolution.. Structure 6: 661 — 672.  PubMed DOI:10.1016/S0969-2126(98)00067-7

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11289 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P36956 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]