ZBTB40

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB40
Ідентифікатори
Символи ZBTB40, ZNF923, zinc finger and BTB domain containing 40
Зовнішні ІД OMIM: 612106 MGI: 2682254 HomoloGene: 8912 GeneCards: ZBTB40
Шаблон експресії
PBB GE ZBTB40 203959 s at fs.png

PBB GE ZBTB40 203958 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001083621
NM_014870
NM_001330398
NM_198248
RefSeq (білок)
NP_001077090
NP_001317327
NP_055685
NP_001077090.1
NP_055685.3
NP_937891
Локус (UCSC) Хр. 1: 22.43 – 22.53 Mb Хр. 4: 136.98 – 137.05 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB40 (англ. Zinc finger and BTB domain containing 40) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 239 амінокислот, а молекулярна маса — 138 118[4].

Послідовність амінокислот
1020304050
MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFK
TLLDNTDTISIDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSL
QMFDVAVSCKNLLTSLVNCSVQGQVVRDVSAPSSETFRKEPEKPQVEILS
SEGAGEPHSSPELAATPGGPVKAETEEAAHSVSQEMSVNSPTAQESQRNA
ETPAETPTTAEACSPSPAVQTFSEAKKTSTEPGCERKHYQLNFLLENEGV
FSDALMVTQDVLKKLEMCSEIKGPQKEMIVKCFEGEGGHSAFQRILGKVR
EESLDVQTVVSLLRLYQYSNPAVKTALLDRKPEDVDTVQPKGSTEEGKTL
SVLLLEHKEDLIQCVTQLRPIMESLETAKEEFLTGTEKRVILNCCEGRTP
KETIENLLHRMTEEKTLTAEGLVKLLQAVKTTFPNLGLLLEKLQKSATLP
STTVQPSPDDYGTELLRRYHENLSEIFTDNQILLKMISHMTSLAPGEREV
MEKLVKRDSGSGGFNSLISAVLEKQTLSATAIWQLLLVVQETKTCPLDLL
MEEIRREPGADAFFRAVTTPEHATLETILRHNQLILEAIQQKIEYKLFTS
EEEHLAETVKEILSIPSETASPEASLRAVLSRAMEKSVPAIEICHLLCSV
HKSFPGLQPVMQELAYIGVLTKEDGEKETWKVSNKFHLEANNKEDEKAAK
EDSQPGEQNDQGETGSLPGQQEKEASASPDPAKKSFICKACDKSFHFYCR
LKVHMKRCRVAKSKQVQCKECSETKDSKKELDKHQLEAHGAGGEPDAPKK
KKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEECGAKFAANST
LKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDA
VFAQSIELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPY
DCKKCRMSFPTLQDHRKHIHEVHSKEYHPCPTCGKIFSAPSMLERHVVTH
VGGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFSSLQCSS
CDKTFPNTIEHKKHIKAEHADMKFHECDQCKELFPTPALLQVHVKCQHSG
SQPFRCLYCAATFRFPGALQHHVTTEHFKQSETTFPCELCGELFTSQAQL
DSHLESEHPKVMSTETQAAASQMAQVIQTPEPVAPTEQVITLEETQLAGS
QVFVTLPDSQASQASSELVAVTVEDLLDGTVTLICGEAK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29045 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9NUA8 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]