ZNF24

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF24
Protein ZNF24 PDB 1x6e.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZNF24, KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191, zinc finger protein 24
Зовнішні ІД OMIM: 194534 MGI: 1929704 HomoloGene: 5068 GeneCards: ZNF24
Шаблон експресії
PBB GE ZNF24 203247 s at fs.png

PBB GE ZNF24 203248 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001308123
NM_006965
NM_001375815
NM_021559
NM_001357447
NM_001357448
RefSeq (білок)
NP_001295052
NP_008896
NP_001362744
NP_067534
NP_001344376
NP_001344377
Локус (UCSC) Хр. 18: 35.33 – 35.35 Mb Хр. 18: 24.01 – 24.02 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF24 (англ. Zinc finger protein 24) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 368 амінокислот, а молекулярна маса — 42 155[4].

Послідовність амінокислот
1020304050
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEI
FRQRFRQFGYQDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQF
VAILPKELQTWVRDHHPENGEEAVTVLEDLESELDDPGQPVSLRRRKREV
LVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGAL
APKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQ
HICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNL
FRHQRRHNAEKLLNVVKV

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gocke C.B., Yu H., Kang J. (2005). Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.. J. Biol. Chem. 280: 5004 — 5012.  PubMed DOI:10.1074/jbc.M411718200
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13032 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P17028 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]