POU3F2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
POU3F2
Ідентифікатори
Символи POU3F2, BRN2, N-Oct3, OCT7, OTF-7, OTF7, POUF3, brn-2, oct-7, POU class 3 homeobox 2
Зовнішні ІД OMIM: 600494 MGI: 101895 HomoloGene: 4095 GeneCards: POU3F2
Шаблон експресії
PBB GE POU3F2 207084 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005604
NM_008899
RefSeq (білок)
NP_005595
NP_032925
Локус (UCSC) Хр. 6: 98.83 – 98.84 Mb Хр. 4: 22.48 – 22.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

POU3F2 (англ. POU class 3 homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 443 амінокислот, а молекулярна маса — 46 893[4].

Послідовність амінокислот
1020304050
MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQS
NGHPLSHAHQWITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQ
PDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQR
PPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGM
LGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPG
HPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAA
QGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRV
WFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Schreiber E., Tobler A., Malipiero U., Schaffner W., Fontana A. (1993). cDNA cloning of human N-Oct3, a nervous-system specific POU domain transcription factor binding to the octamer DNA motif.. Nucleic Acids Res. 21: 253 — 258.  PubMed DOI:10.1093/nar/21.2.253
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9215 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P20265 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]