HOXB13

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXB13
Protein HOXB13 PDB 2cra.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HOXB13, PSGD, homeobox B13, HPC9
Зовнішні ІД OMIM: 604607 MGI: 107730 HomoloGene: 4640 GeneCards: HOXB13
Шаблон експресії
PBB GE HOXB13 209844 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006361
NM_008267
RefSeq (білок)
NP_006352
NP_032293
Локус (UCSC) Хр. 17: 48.72 – 48.73 Mb Хр. 11: 96.19 – 96.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXB13 (англ. Homeobox B13) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 284 амінокислот, а молекулярна маса — 30 676[4].

Послідовність амінокислот
1020304050
MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAP
LDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPC
AQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQ
TLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFA
DSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKIS
AATSLSERQITIWFQNRRVKEKKVLAKVKNSATP

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Breyer J.P., Avritt T.G., McReynolds K.M., Dupont W.D., Smith J.R. (2012). Confirmation of the HOXB13 G84E germline mutation in familial prostate cancer.. Cancer Epidemiol. Biomarkers Prev. 21: 1348 — 1353.  PubMed DOI:10.1158/1055-9965.EPI-12-0495
  • Zeltser L.M., Desplan C., Heintz N. (1996). Hoxb-13: a new Hox gene in a distant region of the HOXB cluster maintains colinearity.. Development 122: 2475 — 2484.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5112 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q92826 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]