DLX6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DLX6
Ідентифікатори
Символи DLX6distal-less homeo box 6homeobox protein DLX-6
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

DLX6 (англ. Distal-less homeobox 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 175 амінокислот, а молекулярна маса — 19 708[2].

Послідовність амінокислот
1020304050
MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIR
KPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNK
RSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPP
NSYMPGYSHWYSSPHQDTMQRPQMM

Кодований геном білок за функцією належить до білків розвитку. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2919 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, P56179 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]