RELB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RELB
Protein RELB PDB 1zk9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RELB, I-REL, IREL, REL-B, RELB proto-oncogene, NF-kB subunit, IMD53
Зовнішні ІД OMIM: 604758 MGI: 103289 HomoloGene: 4747 GeneCards: RELB
Шаблон експресії
PBB GE RELB 205205 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006509
NM_001290457
NM_009046
RefSeq (білок)
NP_006500
NP_001277386
NP_033072
Локус (UCSC) Хр. 19: 45 – 45.04 Mb Хр. 7: 19.61 – 19.63 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RELB (англ. RELB proto-oncogene, NF-kB subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 579 амінокислот, а молекулярна маса — 62 134[4].

Послідовність амінокислот
1020304050
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRS
TDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAP
PATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAG
SILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVG
KDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPY
NAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQ
ADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPR
DHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFLPNHG
SGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPTLFT
MLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTA
SLVGSNMFPNHYREAAFGGGLLSPGPEAT

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dobrzanski P., Ryseck R.P., Bravo R. (1993). Both N- and C-terminal domains of RelB are required for full transactivation: role of the N-terminal leucine zipper-like motif.. Mol. Cell. Biol. 13: 1572 — 1582.  PubMed DOI:10.1128/MCB.13.3.1572
  • Dobrzanski P., Ryseck R.P., Bravo R. (1994). Differential interactions of Rel-NF-kappa B complexes with I kappa B alpha determine pools of constitutive and inducible NF-kappa B activity.. EMBO J. 13: 4608 — 4616.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9956 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q01201 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]