TFAP4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TFAP4
Ідентифікатори
Символи TFAP4, AP-4, bHLHc41, transcription factor AP-4 (activating enhancer binding protein 4), transcription factor AP-4
Зовнішні ІД OMIM: 600743 MGI: 103239 HomoloGene: 2424 GeneCards: TFAP4
Шаблон експресії
PBB GE TFAP4 205688 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003223
NM_031182
RefSeq (білок)
NP_003214
NP_112459
Локус (UCSC) Хр. 16: 4.26 – 4.27 Mb Хр. 16: 4.54 – 4.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TFAP4 (англ. Transcription factor AP-4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 338 амінокислот, а молекулярна маса — 38 726[4].

Послідовність амінокислот
1020304050
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRR
EIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLE
QEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAED
LRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQ
QEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINV
VTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hu Y.-F., Luescher B., Admon A., Mermod N., Tjian R. (1990). Transcription factor AP-4 contains multiple dimerization domains that regulate dimer specificity.. Genes Dev. 4: 1741 — 1752.  PubMed DOI:10.1101/gad.4.10.1741
  • Ou S.H., Garcia-Martinez L.F., Paulssen E.J., Gaynor R.B. (1994). Role of flanking E box motifs in human immunodeficiency virus type 1 TATA element function.. J. Virol. 68: 7188 — 7199.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11745 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q01664 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]