HIVEP2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIVEP2
Ідентифікатори
Символи HIVEP2, HIV-EP2, MBP-2, MIBP1, SHN2, ZAS2, ZNF40B, human immunodeficiency virus type I enhancer binding protein 2, MRD43
Зовнішні ІД OMIM: 143054 MGI: 1338076 HomoloGene: 4900 GeneCards: HIVEP2
Пов'язані генетичні захворювання
autosomal dominant non-syndromic intellectual disability 43[1]
Шаблон експресії
PBB GE HIVEP2 212642 s at fs.png

PBB GE HIVEP2 212641 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006734
NM_010437
NM_001358782
NM_001358783
RefSeq (білок)
NP_006725
NP_034567
NP_001345711
NP_001345712
Локус (UCSC) Хр. 6: 142.75 – 142.96 Mb Хр. 10: 13.97 – 14.15 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HIVEP2 (англ. Human immunodeficiency virus type I enhancer binding protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 446 амінокислот, а молекулярна маса — 269 053[5].

Послідовність амінокислот
1020304050
MDTGDTALGQKATSRSGETDKASGRWRQEQSAVIKMSTFGSHEGQRQPQI
EPEQIGNTASAQLFGSGKLASPSEVVQQVAEKQYPPHRPSPYSCQHSLSF
PQHSLPQGVMHSTKPHQSLEGPPWLFPGPLPSVASEDLFPFPIHGHSGGY
PRKKISSLNPAYSQYSQKSIEQAEEAHKKEHKPKKPGKYICPYCSRACAK
PSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHAHAIKAGLVPF
TESAVSKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLFAEASDKMSPGPP
IPLDIASRGGYHGSLEESLGGPMKVPILIIPKSGIPLPNESSQYIGPDML
PNPSLNTKADDSHTVKQKLALRLSEKKGQDSEPSLNLLSPHSKGSTDSGY
FSRSESAEQQISPPNTNAKSYEEIIFGKYCRLSPRNALSVTTTSQERAAM
GRKGIMEPLPHVNTRLDVKMFEDPVSQLIPSKGDVDPSQTSMLKSTKFNS
ESRQPQIIPSSIRNEGKLYPANFQGSNPVLLEAPVDSSPLIRSNSVPTSS
ATNLTIPPSLRGSHSFDERMTGSDDVFYPGTVGIPPQRMLRRQAAFELPS
VQEGHVEVEHHGRMLKGISSSSLKEKKLSPGDRVGYDYDVCRKPYKKWED
SETPKQNYRDISCLSSLKHGGEYFMDPVVPLQGVPSMFGTTCENRKRRKE
KSVGDEEDTPMICSSIVSTPVGIMASDYDPKLQMQEGVRSGFAMAGHENL
SHGHTERFDPCRPQLQPGSPSLVSEESPSAIDSDKMSDLGGRKPPGNVIS
VIQHTNSLSRPNSFERSESAELVACTQDKAPSPSETCDSEISEAPVSPEW
APPGDGAESGGKPSPSQQVQQQSYHTQPRLVRQHNIQVPEIRVTEEPDKP
EKEKEAQSKEPEKPVEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHS
SGESSFESTGTGLSRSPSQESNLSHSSSFSMSFEREETSKLSALPKQDEF
GKHSEFLTVPAGSYSLSVPGHHHQKEMRRCSSEQMPCPHPAEVPEVRSKS
FDYGNLSHAPVSGAAASTVSPSRERKKCFLVRQASFSGSPEISQGEVGMD
QSVKQEQLEHLHAGLRSGWHHGPPAVLPPLQQEDPGKQVAGPCPPLSSGP
LHLAQPQIMHMDSQESLRNPLIQPTSYMTSKHLPEQPHLFPHQETIPFSP
IQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTE
IHSSYPLEHVAEHTGKKPAEYAHTKEQTYPCYSGASGLHPKNLLPKFPSD
QSSKSTETPSEQVLQEDFASANAGSLQSLPGTVVPVRIQTHVPSYGSVMY
TSISQILGQNSPAIVICKVDENMTQRTLVTNAAMQGIGFNIAQVLGQHAG
LEKYPIWKAPQTLPLGLESSIPLCLPSTSDSVATLGGSKRMLSPASSLEL
FMETKQQKRVKEEKMYGQIVEELSAVELTNSDIKKDLSRPQKPQLVRQGC
ASEPKDGLQSGSSSFSSLSPSSSQDYPSVSPSSREPFLPSKEMLSGSRAP
LPGQKSSGPSESKESSDELDIDETASDMSMSPQSSSLPAGDGQLEEEGKG
HKRPVGMLVRMASAPSGNVADSTLLLTDMADFQQILQFPSLRTTTTVSWC
FLNYTKPNYVQQATFKSSVYASWCISSCNPNPSGLNTKTTLALLRSKQKI
TAEIYTLAAMHRPGTGKLTSSSAWKQFTQMKPDASFLFGSKLERKLVGNI
LKERGKGDIHGDKDIGSKQTEPIRIKIFEGGYKSNEDYVYVRGRGRGKYI
CEECGIRCKKPSMLKKHIRTHTDVRPYVCKLCNFAFKTKGNLTKHMKSKA
HMKKCLELGVSMTSVDDTETEEAENLEDLHKAAEKHSMSSISTDHQFSDA
EESDGEDGDDNDDDDEDEDDFDDQGDLTPKTRSRSTSPQPPRFSSLPVNV
GAVPHGVPSDSSLGHSSLISYLVTLPSIRVTQLMTPSDSCEDTQMTEYQR
LFQSKSTDSEPDKDRLDIPSCMDEECMLPSEPSSSPRDFSPSSHHSSPGY
DSSPCRDNSPKRYLIPKGDLSPRRHLSPRRDLSPMRHLSPRKEAALRREM
SQRDVSPRRHLSPRRPVSPGKDITARRDLSPRRERRYMTTIRAPSPRRAL
YHNPPLSMGQYLQAEPIVLGPPNLRRGLPQVPYFSLYGDQEGAYEHPGSS
LFPEGPNDYVFSHLPLHSQQQVRAPIPMVPVGGIQMVHSMPPALSSLHPS
PTLPLPMEGFEEKKGASGESFSKDPYVLSKQHEKRGPHALQSSGPPSTPS
SPRLLMKQSTSEDSLNATEREQEENIQTCTKAIASLRIATEEAALLGPDQ
PARVQEPHQNPLGSAHVSIRHFSRPEPGQPCTSATHPDLHDGEKDNFGTS
QTPLAHSTFYSKSCVDDKQLDFHSSKELSSSTEESKDPSSEKSQLH

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Van't Veer L.J., Lutz P., Isselbacher K.J., Bernards R. (1992). Structure and expression of MBP-2: a 275 kDa zinc finger protein that binds to an enhancer of major histocompatibility complex class 1 genes.. Proc. Natl. Acad. Sci. U.S.A. 89: 8971 — 8975.  PubMed DOI:10.1073/pnas.89.19.8971
  • Rustgi A.K., Van't Veer L.J., Bernards R. (1990). Two genes encode factors with NF-kappa B- and H2TF1-like DNA-binding properties.. Proc. Natl. Acad. Sci. U.S.A. 87: 8707 — 8710.  PubMed DOI:10.1073/pnas.87.22.8707

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]