PBX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PBX1
HoxB1-Pbx1 heterodimer binding DNA 1b72.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PBX1, PBX homeobox 1, CAKUHED
Зовнішні ІД OMIM: 176310 MGI: 97495 HomoloGene: 20574 GeneCards: PBX1
Пов'язані генетичні захворювання
рак молочної залози[1]
Шаблон експресії
PBB GE PBX1 205253 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001204961
NM_001204963
NM_002585
NM_001353130
NM_001353131
NM_001291508
NM_001291509
NM_008783
NM_183355
RefSeq (білок)
NP_001191890
NP_001191892
NP_002576
NP_001340059
NP_001340060
NP_001278437
NP_001278438
NP_032809
NP_899198
Локус (UCSC) Хр. 1: 164.56 – 164.9 Mb Хр. 1: 168.12 – 168.43 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PBX1 (англ. PBX homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 430 амінокислот, а молекулярна маса — 46 626[5].

Послідовність амінокислот
1020304050
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQI
MTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEP
TDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDY
RAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERM
VSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNE
YFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSV
QSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGIS
ANGGWQDATTPSSVTSPTEGPGSVHSDTSN

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Monica K., Galili N., Nourse J., Saltman D., Cleary M.L. (1991). PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1.. Mol. Cell. Biol. 11: 6149 — 6157.  PubMed DOI:10.1128/MCB.11.12.6149
  • Thameem F., Wolford J.K., Bogardus C., Prochazka M. (2001). Analysis of PBX1 as a candidate gene for type 2 diabetes mellitus in Pima Indians.. Biochim. Biophys. Acta 1518: 215 — 220.  PubMed DOI:10.1016/S0167-4781(01)00189-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kamps M.P., Murre C., Sun X.-H., Baltimore D. (1990). A new homeobox gene contributes the DNA binding domain of the t(1;19) translocation protein in pre-B ALL.. Cell 60: 547 — 555.  PubMed DOI:10.1016/0092-8674(90)90658-2
  • van Dijk M.A., Voorhoeve P.M., Murre C. (1993). Pbx1 is converted into a transcriptional activator upon acquiring the N-terminal region of E2A in pre-B-cell acute lymphoblastoid leukemia.. Proc. Natl. Acad. Sci. U.S.A. 90: 6061 — 6065.  PubMed DOI:10.1073/pnas.90.13.6061
  • Lu Q., Wright D.D., Kamps M.P. (1994). Fusion with E2A converts the Pbx1 homeodomain protein into a constitutive transcriptional activator in human leukemias carrying the t(1;19) translocation.. Mol. Cell. Biol. 14: 3938 — 3948.  PubMed DOI:10.1128/MCB.14.6.3938

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]