MXD4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MXD4
Ідентифікатори
Символи MXD4, MAD4, MST149, MSTP149, bHLHc12, MAX dimerization protein 4
Зовнішні ІД MGI: 104991 HomoloGene: 4712 GeneCards: MXD4
Шаблон експресії
PBB GE MXD4 212347 x at fs.png

PBB GE MXD4 210778 s at fs.png

PBB GE MXD4 212346 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006454
NM_010753
RefSeq (білок)
NP_006445
н/д
Локус (UCSC) Хр. 4: 2.25 – 2.26 Mb Хр. 5: 34.17 – 34.19 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MXD4 (англ. MAX dimerization protein 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 209 амінокислот, а молекулярна маса — 23 528[4].

Послідовність амінокислот
1020304050
MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRK
APNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKV
HIKKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAV
STDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHC
RRLGRPALS

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13906 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q14582 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]