PRDM9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PRDM9
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PRDM9, MEISETZ, MSBP3, PFM6, PRMD9, ZNF899, PR domain 9, PR/SET domain 9, KMT8B
Зовнішні ІД OMIM: 609760 MGI: 2384854 HomoloGene: 104139 GeneCards: PRDM9
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020227
NM_001310214
NM_001376900
NM_144809
NM_001361436
RefSeq (білок)
NP_001297143
NP_064612
NP_001363829
NP_659058
NP_001348365
Локус (UCSC) Хр. 5: 23.44 – 23.53 Mb Хр. 17: 15.54 – 15.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PRDM9 (англ. PR/SET domain 9, PR domain zinc finger protein 9) – білок, який кодується геном PRDM9, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 894 амінокислот, а молекулярна маса — 103 376[4]. Фермент, який здатен додавати три метильні групи до 4-го лізину H3-гістону (H3K4-3me, див. табл "Порівняння еу- та гетерохроматину")[5]. Структурно Prdm9 має домен KRAB, та декілька тандемних цинкових пальців C2H2, що здатні зв'язуватися з ДНК[6]. Функції Prdm9 полягають у триметилюванні H3K4 під час мейотичної профази, що є потрібною стадією для проходження мейозу. Проте білок Prdm9 не здатен до ди- та моно-метилювання 4-го лізину H3-гістону[en].

Цей білок за функціями належить до трансфераз, активаторів, регуляторів хроматину, метилтрансфераз. Задіяний у таких біологічних процесах, як регуляція транскрипції, мейоз. Білок має сайт для зв'язування з іоном цинку, S-аденозил-L-метіоніном. Локалізований у ядрі, хромосомах.

Послідовність амінокислот
1020304050
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTR
YRNVKRNYNALITIGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQ
VKPPWMALRVEQRKHQKGMPKASFSNESSLKELSRTANLLNASGSEQAQK
PVSPSGEASTSGQHSRLKLELRKKETERKMYSLRERKGHAYKEVSEPQDD
DYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGP
SGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANNGYSWLITKGRN
CYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPG
CELLVWYGDEYGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQ
KFLSQHVERNHSSQNFPGPSARKLLQPENPCPGDQNQEQQYPDPHSRNDK
TKGQEIKERSKLLNKRTWQREISRAFSSPPKGQMGSCRVGKRIMEEESRT
GQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVITHQRTHTGEK
LYVCRECGRGFSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQR
THTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSRQSV
LLTHQRRHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRG
FSWQSVLLTHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVC
RECGRGFRDKSHLLRHQRTHTGEKPYVCRECGRGFRDKSNLLSHQRTHTG
EKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRNKSHLLRH
QRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE

Див. також[ред. | ред. код]

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13994 (англ.). Процитовано 12 лютого 2018. 
  4. UniProt, Q9NQV7 (англ.). Процитовано 12 лютого 2018. 
  5. Entrez Gene: PR domain containing 9. 
  6. Thomas JH, Emerson RO, Shendure J (2009). Extraordinary molecular evolution in the PRDM9 fertility gene. PLoS ONE 4 (12): e8505. PMC 2794550. PMID 20041164. doi:10.1371/journal.pone.0008505. 

Література[ред. | ред. код]

  • Jiang G.L., Huang S. (2000). The yin-yang of PR-domain family genes in tumorigenesis.. Histol. Histopathol. 15: 109 — 117.  PubMed