RFXANK

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RFXANK
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RFXANK, ANKRA1, BLS, F14150_1, RFX-B, regulatory factor X associated ankyrin containing protein
Зовнішні ІД OMIM: 603200 MGI: 1333865 HomoloGene: 2760 GeneCards: RFXANK
Шаблон експресії
PBB GE RFXANK 202758 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001025589
NM_011266
RefSeq (білок)
NP_001020760
NP_035396
Локус (UCSC) Хр. 19: 19.19 – 19.2 Mb Хр. 8: 70.13 – 70.14 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RFXANK (англ. Regulatory factor X associated ankyrin containing protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 260 амінокислот, а молекулярна маса — 28 102[4].

Послідовність амінокислот
1020304050
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPV
NPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQ
GELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGADP
HILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRG
NHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLF
QSNLVPADPE

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Laird K.M., Briggs L.L., Boss J.M., Summers M.F., Garvie C.W. (2010). Solution structure of the heterotrimeric complex between the interaction domains of RFX5 and RFXAP from the RFX gene regulatory complex.. J. Mol. Biol. 403: 40 — 51.  PubMed DOI:10.1016/j.jmb.2010.08.025
  • Nagarajan U.M., Peijnenburg A., Gobin S.J., Boss J.M., van den Elsen P.J. (2000). Novel mutations within the RFX-B gene and partial rescue of MHC and related genes through exogenous class II transactivator in RFX-B-deficient cells.. J. Immunol. 164: 3666 — 3674.  PubMed DOI:10.4049/jimmunol.164.7.3666

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9987 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O14593 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]