NFE2L2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFE2L2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFE2L2, NRF2, HEBP1, nuclear factor, erythroid 2 like 2, IMDDHH, Nrf-2
Зовнішні ІД OMIM: 600492 MGI: 108420 HomoloGene: 2412 GeneCards: NFE2L2
Шаблон експресії
PBB GE NFE2L2 201146 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_010902
RefSeq (білок)
NP_035032
Локус (UCSC) Хр. 2: 177.23 – 177.39 Mb Хр. 2: 75.68 – 75.7 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFE2L2 (англ. Nuclear factor, erythroid 2 like 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 605 амінокислот, а молекулярна маса — 67 827[4].

Послідовність амінокислот
1020304050
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEK
QKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSA
NYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGH
IESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCL
NIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAF
EDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNT
SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSS
GDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRL
EAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRD
IRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSL
HLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Moi P., Chan K., Asunis I., Cao A., Kan Y.W. (1994). Isolation of NF-E2-related factor 2 (Nrf2), a NF-E2-like basic leucine zipper transcriptional activator that binds to the tandem NF-E2/AP1 repeat of the beta-globin locus control region.. Proc. Natl. Acad. Sci. U.S.A. 91: 9926 — 9930.  PubMed DOI:10.1073/pnas.91.21.9926
  • Huang H.-C., Nguyen T., Pickett C.B. (2000). Regulation of the antioxidant response element by protein kinase C-mediated phosphorylation of NF-E2-related factor 2.. Proc. Natl. Acad. Sci. U.S.A. 97: 12475 — 12480.  PubMed DOI:10.1073/pnas.220418997
  • Wang Y., Devereux W., Stewart T.M., Casero R.A. Jr. (2001). Characterization of the interaction between the transcription factors human polyamine modulated factor (PMF-1) and NF-E2-related factor 2 (Nrf-2) in the transcriptional regulation of the spermidine/spermine N1-acetyltransferase (SSAT) gene.. Biochem. J. 355: 45 — 49.  PubMed DOI:10.1042/0264-6021:3550045
  • Lo S.-C., Hannink M. (2008). PGAM5 tethers a ternary complex containing Keap1 and Nrf2 to mitochondria.. Exp. Cell Res. 314: 1789 — 1803.  PubMed DOI:10.1016/j.yexcr.2008.02.014
  • Wang X.J., Zhang D.D. (2009). Ectodermal-neural cortex 1 down-regulates Nrf2 at the translational level.. PLoS ONE 4: E5492 — E5492.  PubMed DOI:10.1371/journal.pone.0005492

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7782 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q16236 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]