HIVEP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIVEP1
Protein HIVEP1 PDB 1bbo.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HIVEP1, CIRIP, CRYBP1, GAAP, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A, human immunodeficiency virus type I enhancer binding protein 1, HIVEP zinc finger 1
Зовнішні ІД OMIM: 194540 MGI: 96100 HomoloGene: 1596 GeneCards: HIVEP1
Пов'язані генетичні захворювання
токсикоманія[1]
Шаблон експресії
PBB GE HIVEP1 204512 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002114
NM_007772
RefSeq (білок)
NP_002105
NP_031798
Локус (UCSC) Хр. 6: 12.01 – 12.16 Mb Хр. 13: 42.05 – 42.19 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HIVEP1 (англ. Human immunodeficiency virus type I enhancer binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 718 амінокислот, а молекулярна маса — 296 865[5].

Послідовність амінокислот
1020304050
MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKR
KKIVAENHLKKIPKSPLRNPLQAKHKQNTEESSFAVLHSASESHKKQNYI
PVKNGKQFTKQNGETPGIIAEASKSEESVSPKKPLFLQQPSELRRWRSEG
ADPAKFSDLDEQCDSSSLSSKTRTDNSECISSHCGTTSPSYTNTAFDVLL
KAMEPELSTLSQKGSPCAIKTEKLRPNKTARSPPKLKNSSMDAPNQTSQE
LVAESQSSCTSYTVHMSAAQKNEQGAMQSASHLYHQHEHFVPKSNQHNQQ
LPGCSGFTGSLTNLQNQENAKLEQVYNIAVTSSVGLTSPSSRSQVTPQNQ
QMDSASPLSISPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKP
KKQGKYICEYCNRACAKPSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLY
KHKKSHAHTIKLGLVLQPDAGGLFLSHESPKALSIHSDVEDSGESEEEGA
TDERQHDLGAMELQPVHIIKRMSNAETLLKSSFTPSSPENVIGDFLLQDR
SAESQAVTELPKVVVHHVTVSPLRTDSPKAMDPKPELSSAQKQKDLQVTN
VQPLSANMSQGGVSRLETNENSHQKGDMNPLEGKQDSHVGTVHAQLQRQQ
ATDYSQEQQGKLLSPRSLGSTDSGYFSRSESADQTVSPPTPFARRLPSTE
QDSGRSNGPSAALVTTSTPSALPTGEKALLLPGQMRPPLATKTLEERISK
LISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQFDLKPVG
RRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAV
PANIIPPPHPLRGSQSFDDKIGTFYDDVFVSGPNAPVPQSGHPRTLVRQA
AIEDSSANESHVLGTGQSLDESHQGCHAAGEAMSVRSKALAQGPHIEKKK
SHQGRGTMFECETCRNRYRKLENFENHKKFYCSELHGPKTKVAMREPEHS
PVPGGLQPQILHYRVAGSSGIWEQTPQIRKRRKMKSVGDDEELQQNESGT
SPKSSEGLQFQNALGCNPSLPKHNVTIRSDQQHKNIQLQNSHIHLVARGP
EQTMDPKLSTIMEQQISSAAQDKIELQRHGTGISVIQHTNSLSRPNSFDK
PEPFERASPVSFQELNRTGKSGSLKVIGISQEESHPSRDGSHPHQLALSD
ALRGELQESSRKSPSERHVLGQPSRLVRQHNIQVPEILVTEEPDRDLEAQ
CHDQEKSEKFSWPQRSETLSKLPTEKLPPKKKRLRLAEIEHSSTESSFDS
TLSRSLSRESSLSHTSSFSASLDIEDVSKTEASPKIDFLNKAEFLMIPAG
LNTLNVPGCHREMRRTASEQINCTQTSMEVSDLRSKSFDCGSITPPQTTP
LTELQPPSSPSRVGVTGHVPLLERRRGPLVRQISLNIAPDSHLSPVHPTS
FQNTALPSVNAVPYQGPQLTSTSLAEFSANTLHSQTQVKDLQAETSNSSS
TNVFPVQQLCDINLLNQIHAPPSHQSTQLSLQVSTQGSKPDKNSVLSGSS
KSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSAT
LPTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFA
TLTSLPQILVTQDLPNQPICQTNHSVVPISEEQNSVPTLQKGHQNALPNP
EKEFLCENVFSEMSQNSSLSESLPITQKISVGRLSPQQESSASSKRMLSP
ANSLDIAMEKHQKRAKDENGAVCATDVRPLEALSSRVNEASKQKKPILVR
QVCTTEPLDGVMLEKDVFSQPEISNEAVNLTNVLPADNSSTGCSKFVVIE
PISELQEFENIKSSTSLTLTVRSSPAPSENTHISPLKCTDNNQERKSPGV
KNQGDKVNIQEQSQQPVTSLSLFNIKDTQQLAFPSLKTTTNFTWCYLLRQ
KSLHLPQKDQKTSAYTDWTVSASNPNPLGLPTKVALALLNSKQNTGKSLY
CQAITTHSKSDLLVYSSKWKSSLSKRALGNQKSTVVEFSNKDASEINSEQ
DKENSLIKSEPRRIKIFDGGYKSNEEYVYVRGRGRGKYICEECGIRCKKP
SMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKKCVDLGVS
VGLIDEQDTEESDEKQRFSYERSGYDLEESDGPDEDDNENEDDDEDSQAE
SVLSATPSVTASPQHLPSRSSLQDPVSTDEDVRITDCFSGVHTDPMDVLP
RALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCH
QMSVDYPESEEILRSSMAGKAVAITQSPSSVRLPPAAAEHSPQTAAGMPS
VASPHPDPQEQKQQITLQPTPGLPSPHTHLFSHLPLHSQQQSRTPYNMVP
VGGIHVVPAGLTYSTFVPLQAGPVQLTIPAVSVVHRTLGTHRNTVTEVSG
TTNPAGVAELSSVVPCIPIGQIRVPGLQNLSTPGLQSLPSLSMETVNIVG
LANTNMAPQVHPPGLALNAVGLQVLTANPSSQSSPAPQAHIPGLQILNIA
LPTLIPSVSQVAVDAQGAPEMPASQSKACETQPKQTSVASANQVSRTESP
QGLPTVQRENAKKVLNPPAPAGDHARLDGLSKMDTEKAASANHVKPKPEL
TSIQGQPASTSQPLLKAHSEVFTKPSGQQTLSPDRQVPRPTALPRRQPTV
HFSDVSSDDDEDRLVIAT

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Fan C.M., Maniatis T. (1990). A DNA-binding protein containing two widely separated zinc finger motifs that recognize the same DNA sequence.. Genes Dev. 4: 29 — 42.  PubMed DOI:10.1101/gad.4.1.29
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Baldwin A.S. Jr., LeClair K.P., Singh H., Sharp P.A. (1990). A large protein containing zinc finger domains binds to related sequence elements in the enhancers of the class I major histocompatibility complex and kappa immunoglobulin genes.. Mol. Cell. Biol. 10: 1406 — 1414.  PubMed DOI:10.1128/MCB.10.4.1406
  • Lallemand C., Palmieri M., Blanchard B., Meritet J.F., Tovey M.G. (2002). GAAP-1: a transcriptional activator of p53 and IRF-1 possesses pro-apoptotic activity.. EMBO Rep. 3: 153 — 158.  PubMed DOI:10.1093/embo-reports/kvf032
  • Yu B., Mitchell G.A., Richter A. (2009). Cirhin up-regulates a canonical NF-kappaB element through strong interaction with Cirip/HIVEP1.. Exp. Cell Res. 315: 3086 — 3098.  PubMed DOI:10.1016/j.yexcr.2009.08.017
  • Omichinski J.G., Clore G.M., Appella E., Sakaguchi K., Gronenborn A.M. (1990). High-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution.. Biochemistry 29: 9324 — 9334.  PubMed DOI:10.1021/bi00492a004

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]