NFATC2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFATC2
Protein NFATC2 PDB 1a02.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFATC2, NFAT1, NFATP, nuclear factor of activated T-cells 2, nuclear factor of activated T cells 2
Зовнішні ІД OMIM: 600490 MGI: 102463 HomoloGene: 7861 GeneCards: NFATC2
Пов'язані генетичні захворювання
бічний аміотрофічний склероз[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 20: 51.39 – 51.56 Mb Хр. 2: 168.48 – 168.6 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFATC2 (англ. Nuclear factor of activated T-cells 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 925 амінокислот, а молекулярна маса — 100 146[5].

Послідовність амінокислот
1020304050
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHK
VASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSA
AKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPR
FTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDD
LCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGA
KRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVE
FLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWP
LSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYME
NKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLE
IPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHI
PESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHI
RTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHG
GLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAV
LYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHP
SPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVS
QGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
DQTYLDDVNEIIRKEFSGPPARNQT

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Vihma H., Pruunsild P., Timmusk T. (2008). Alternative splicing and expression of human and mouse NFAT genes.. Genomics 92: 279 — 291.  PubMed DOI:10.1016/j.ygeno.2008.06.011
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Crabtree G.R. (1999). Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.. Cell 96: 611 — 614.  PubMed DOI:10.1016/S0092-8674(00)80571-1
  • Bettelli E., Dastrange M., Oukka M. (2005). Foxp3 interacts with nuclear factor of activated T cells and NF-kappa B to repress cytokine gene expression and effector functions of T helper cells.. Proc. Natl. Acad. Sci. U.S.A. 102: 5138 — 5143.  PubMed DOI:10.1073/pnas.0501675102
  • Yiu G.K., Kaunisto A., Chin Y.R., Toker A. (2011). NFAT promotes carcinoma invasive migration through glypican-6.. Biochem. J. 440: 157 — 166.  PubMed DOI:10.1042/BJ20110530

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]