AATF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
AATF
Ідентифікатори
Символи AATF, BFR2, CHE-1, CHE1, DED, Apoptosis-antagonizing transcription factor, apoptosis antagonizing transcription factor
Зовнішні ІД OMIM: 608463 MGI: 1929608 HomoloGene: 40811 GeneCards: AATF
Пов'язані генетичні захворювання
Ожиріння[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012138
NM_019816
RefSeq (білок)
NP_036270
NP_062790
Локус (UCSC) Хр. 17: 36.95 – 37.06 Mb Хр. 11: 84.42 – 84.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

AATF (англ. Apoptosis antagonizing transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 560 амінокислот, а молекулярна маса — 63 133[5].

Послідовність амінокислот
1020304050
MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF
LVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD
EEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFS
VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGD
RNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
TNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQY
PDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPS
FMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHIL
MDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHL
KDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSK
IHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQ
LHPPDEGHGD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Guo Q., Xie J. (2004). AATF inhibits aberrant production of amyloid beta peptide 1-42 by interacting directly with Par-4.. J. Biol. Chem. 279: 4596 — 4603.  PubMed DOI:10.1074/jbc.M309811200
  • Xie J., Guo Q. (2004). AATF protects neural cells against oxidative damage induced by amyloid beta-peptide.. Neurobiol. Dis. 16: 150 — 157.  PubMed DOI:10.1016/j.nbd.2004.02.003

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]