HEYL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HEYL
Ідентифікатори
Символи HEYL, HESR3, HEY3, HRT3, bHLHb33, hes related family bHLH transcription factor with YRPW motif-like, hes related family bHLH transcription factor with YRPW motif like
Зовнішні ІД OMIM: 609034 MGI: 1860511 HomoloGene: 8494 GeneCards: HEYL
Шаблон експресії
PBB GE HEYL 220662 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014571
NM_013905
RefSeq (білок)
NP_055386
NP_038933
Локус (UCSC) Хр. 1: 39.62 – 39.64 Mb Хр. 4: 123.23 – 123.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HEYL (англ. Hes related family bHLH transcription factor with YRPW motif-like) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 328 амінокислот, а молекулярна маса — 35 087[4].

Послідовність амінокислот
1020304050
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGI
IEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHA
TGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVRIRLL
SHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVP
SPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSRGASSTRRARP
LERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNS
SSPGPAGRPAGAMLYHSWVSEITEIGAF

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Maier M.M., Gessler M. (2000). Comparative analysis of the human and mouse Hey1 promoter: Hey genes are new Notch target genes.. Biochem. Biophys. Res. Commun. 275: 652 — 660.  PubMed DOI:10.1006/bbrc.2000.3354

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4882 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9NQ87 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]