STAT4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT4
Ідентифікатори
Символи STAT4, SLEB11, signal transducer and activator of transcription 4
Зовнішні ІД OMIM: 600558 MGI: 103062 HomoloGene: 20679 GeneCards: STAT4
Пов'язані генетичні захворювання
Ревматоїдний артрит, синдром Бехчета, hepatocellular carcinoma, primary biliary cirrhosis, Системна склеродермія, Целіакія, системний червоний вовчак[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243835
NM_003151
NM_011487
NM_001308266
RefSeq (білок)
NP_001230764
NP_003142
NP_001295195
NP_035617
Локус (UCSC) Хр. 2: 191.03 – 191.15 Mb Хр. 1: 51.99 – 52.11 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT4 (англ. Signal transducer and activator of transcription 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 748 амінокислот, а молекулярна маса — 85 941[5].

Послідовність амінокислот
1020304050
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNE
TMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMH
VAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAI
KNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQE
MLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGP
LHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKL
PELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFR
HLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLP
VVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSW
QFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTF
WTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMA
ENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIP
ISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yao B.B., Niu P., Surowy C.S., Faltynek C.R. (1999). Direct interaction of STAT4 with the IL-12 receptor.. Arch. Biochem. Biophys. 368: 147 — 155.  PubMed DOI:10.1006/abbi.1999.1302
  • Naeger L.K., McKinney J., Salvekar A., Hoey T. (1999). Identification of a STAT4 binding site in the interleukin-12 receptor required for signaling.. J. Biol. Chem. 274: 1875 — 1878.  PubMed DOI:10.1074/jbc.274.4.1875

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]