TAF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF3, TAF140, TAFII-140, TAFII140, TATA-box binding protein associated factor 3
Зовнішні ІД OMIM: 606576 MGI: 2388097 HomoloGene: 35415 GeneCards: TAF3
Шаблон експресії
PBB GE TAF3 gnf1h10566 at fs.png

PBB GE TAF3 gnf1h06476 at fs.png

PBB GE TAF3 gnf1h05253 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_031923
NM_027748
RefSeq (білок)
NP_114129
NP_082024
Локус (UCSC) Хр. 10: 7.82 – 8.02 Mb Хр. 2: 9.91 – 10.05 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF3 (англ. TATA-box binding protein associated factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 929 амінокислот, а молекулярна маса — 103 582[4].

Послідовність амінокислот
1020304050
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCH
RYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFP
VSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTS
AEAMQVPLEEDDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLST
KGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLAPPSPEPPMLA
PVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIR
SPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSE
KISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACA
EREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTP
LPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPP
TPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNK
DKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDP
KVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAP
APPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKE
KKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPV
ALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPA
PAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTE
TVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTA
PPEEMQWFCPKCANKKKDKKHKKRKHRAH

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17303 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q5VWG9 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]