FOSL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOSL1
Ідентифікатори
Символи FOSL1, FRA, FRA1, fra-1, FOS like 1, AP-1 transcription factor subunit
Зовнішні ІД OMIM: 136515 MGI: 107179 HomoloGene: 3967 GeneCards: FOSL1
Шаблон експресії
PBB GE FOSL1 213250 at fs.png

PBB GE FOSL1 204420 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001300844
NM_001300855
NM_001300856
NM_001300857
NM_005438
NM_010235
RefSeq (білок)
NP_001287773
NP_001287784
NP_001287785
NP_001287786
NP_005429
NP_034365
Локус (UCSC) Хр. 11: 65.89 – 65.9 Mb Хр. 19: 5.45 – 5.46 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOSL1 (англ. FOS like 1, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 271 амінокислот, а молекулярна маса — 29 413[4].

Послідовність амінокислот
1020304050
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQEL
QWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
SPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQRE
IEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVP
CISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRK
SSSSSGDPSSDPLGSPTLLAL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Matsui M., Tokuhara M., Konuma Y., Nomura N., Ishizaki R. (1990). Isolation of human fos-related genes and their expression during monocyte-macrophage differentiation.. Oncogene 5: 249 — 255.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13718 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P15407 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]