FOXO3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXO3
Ідентифікатори
Символи forkhead box protein O3forkhead homolog (rhabdomyosarcoma) like 1AF6q21 proteinforkhead box O3AforkheadDrosophilahomolog ofin rhabdomyosarcoma-like 1forkhead in rhabdomyosarcoma-like 1FOXO3
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

FOXO3 (англ. Forkhead box O3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 673 амінокислот, а молекулярна маса — 71 277[2].

Послідовність амінокислот
1020304050
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGE
TAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARV
LAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKC
SSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDS
NSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRR
AVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS
SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQ
PSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQT
IQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAV
SAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRAL
SNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQN
VVGLNVGNFTGAKQASSQSWVPG

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Anderson M.J., Viars C.S., Czekay S., Cavenee W.K., Arden K.C. (1998). Cloning and characterization of three human forkhead genes that comprise an FKHR-like gene subfamily.. Genomics 47: 187 — 199.  PubMed DOI:10.1006/geno.1997.5122
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Morishita D., Katayama R., Sekimizu K., Tsuruo T., Fujita N. (2008). Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels.. Cancer Res. 68: 5076 — 5085.  PubMed DOI:10.1158/0008-5472.CAN-08-0634
  • Tezil T., Bodur C., Kutuk O., Basaga H. (2012). IKK-beta mediates chemoresistance by sequestering FOXO3; a critical factor for cell survival and death.. Cell. Signal. 24: 1361 — 1368.  PubMed DOI:10.1016/j.cellsig.2012.01.012
  • Ghosh A.P., Klocke B.J., Ballestas M.E., Roth K.A. (2012). CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress.. PLoS ONE 7: E39586 — E39586.  PubMed DOI:10.1371/journal.pone.0039586
  • Hillion J., Le Coniat M., Jonveaux P., Berger R., Bernard O.A. (1997). AF6q21, a novel partner of the MLL gene in t(6;11)(q21;q23), defines a forkhead transcriptional factor subfamily.. Blood 90: 3714 — 3719.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3821 (англ.). Процитовано 6 вересня 2017. 
  2. UniProt, O43524 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]