ILF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ILF2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ILF2, NF45, PRO3063, interleukin enhancer binding factor 2
Зовнішні ІД OMIM: 603181 MGI: 1915031 HomoloGene: 26894 GeneCards: ILF2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004515
NM_001267809
NM_026374
RefSeq (білок)
NP_001254738
NP_004506
NP_080650
Локус (UCSC) Хр. 1: 153.66 – 153.67 Mb Хр. 3: 90.48 – 90.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ILF2 (англ. Interleukin enhancer binding factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 390 амінокислот, а молекулярна маса — 43 062[4].

Послідовність амінокислот
1020304050
MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDE
TSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIE
EVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQD
PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQS
ALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH
YAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT
VMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI
VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ting N.S.Y., Kao P.N., Chan D.W., Lintott L.G., Lees-Miller S.P. (1998). DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.. J. Biol. Chem. 273: 2136 — 2145.  PubMed DOI:10.1074/jbc.273.4.2136
  • Reichman T.W., Muniz L.C., Mathews M.B. (2002). The RNA binding protein nuclear factor 90 functions as both a positive and negative regulator of gene expression in mammalian cells.. Mol. Cell. Biol. 22: 343 — 356.  PubMed DOI:10.1128/MCB.22.1.343-356.2002
  • Harashima A., Guettouche T., Barber G.N. (2010). Phosphorylation of the NFAR proteins by the dsRNA-dependent protein kinase PKR constitutes a novel mechanism of translational regulation and cellular defense.. Genes Dev. 24: 2640 — 2653.  PubMed DOI:10.1101/gad.1965010

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6037 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q12905 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]