USF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
USF1
Protein USF1 PDB 1an4.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи USF1, FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11, upstream transcription factor 1
Зовнішні ІД OMIM: 191523 MGI: 99542 HomoloGene: 31426 GeneCards: USF1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_207005
NM_001276373
NM_007122
NM_009480
NM_001305676
NM_001305677
NM_001305678
RefSeq (білок)
NP_001263302
NP_009053
NP_996888
NP_001292605
NP_001292606
NP_001292607
NP_033506
Локус (UCSC) Хр. 1: 161.04 – 161.05 Mb Хр. 1: 171.41 – 171.42 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

USF1 (англ. Upstream transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 310 амінокислот, а молекулярна маса — 33 538[4].

Послідовність амінокислот
1020304050
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYV
FRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFT
SDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEALLG
QATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKR
RAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDY
IQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Gregor P.D., Sawadogo M., Roeder R.G. (1990). The adenovirus major late transcription factor USF is a member of the helix-loop-helix group of regulatory proteins and binds to DNA as a dimer.. Genes Dev. 4: 1730 — 1740.  PubMed DOI:10.1101/gad.4.10.1730
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rahaus M., Desloges N., Yang M., Ruyechan W.T., Wolff M.H. (2003). Transcription factor USF, expressed during the entire phase of Varicella-zoster virus infection, interacts physically with the major viral transactivator IE62 and plays a significant role in virus replication.. J. Gen. Virol. 84: 2957 — 2967.  PubMed DOI:10.1099/vir.0.19335-0
  • Ferre-D'Amare A.R., Pognonec P., Roeder R.G., Burley S.K. (1994). Structure and function of the b/HLH/Z domain of USF.. EMBO J. 13: 180 — 189.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12593 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P22415 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]