XBP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
XBP1
Ідентифікатори
Символи XBP1, TREB5, XBP-1, XBP2, TREB-5, X-box binding protein 1
Зовнішні ІД OMIM: 194355 MGI: 98970 HomoloGene: 3722 GeneCards: XBP1
Пов'язані генетичні захворювання
esophagus squamous cell carcinoma[1]
Шаблон експресії
PBB GE XBP1 200670 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005080
NM_001079539
NM_001271730
NM_013842
RefSeq (білок)
NP_001073007
NP_005071
NP_001258659
NP_038870
Локус (UCSC) Хр. 22: 28.79 – 28.8 Mb Хр. 11: 5.52 – 5.53 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

XBP1 (англ. X-box binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 261 амінокислот, а молекулярна маса — 28 695[5].

Послідовність амінокислот
1020304050
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEA
ASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQ
QVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEA
KGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQS
LISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWG
RHQPSWKPLMN

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, відповідь на стрес, транскрипція, регуляція транскрипції, метаболізм ліпідів, транспорт, транспорт білків, відповідь на порушення конформації білку, ангіогенез, автофагія, біосинтез ліпідів, диференціація клітин, міогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі, мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Yoshida H., Matsui T., Yamamoto A., Okada T., Mori K. (2001). XBP1 mRNA is induced by ATF6 and spliced by IRE1 in response to ER stress to produce a highly active transcription factor.. Cell 107: 881 — 891.  PubMed DOI:10.1016/S0092-8674(01)00611-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ono S.J., Liou H.C., Davidon R., Strominger J.L., Glimcher L.H. (1991). Human X-box-binding protein 1 is required for the transcription of a subset of human class II major histocompatibility genes and forms a heterodimer with c-fos.. Proc. Natl. Acad. Sci. U.S.A. 88: 4309 — 4312.  PubMed DOI:10.1073/pnas.88.10.4309
  • Clauss I.M., Chu M., Zhao J.-L., Glimcher L.H. (1996). The basic domain/leucine zipper protein hXBP-1 preferentially binds to and transactivates CRE-like sequences containing an ACGT core.. Nucleic Acids Res. 24: 1855 — 1864.  PubMed DOI:10.1093/nar/24.10.1855
  • Sriburi R., Jackowski S., Mori K., Brewer J.W. (2004). XBP1: a link between the unfolded protein response, lipid biosynthesis, and biogenesis of the endoplasmic reticulum.. J. Cell Biol. 167: 35 — 41.  PubMed DOI:10.1083/jcb.200406136
  • Yoshida H., Nadanaka S., Sato R., Mori K. (2006). XBP1 is critical to protect cells from endoplasmic reticulum stress: evidence from Site-2 protease-deficient Chinese hamster ovary cells.. Cell Struct. Funct. 31: 117 — 125.  PubMed DOI:10.1247/csf.06016

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]