GLIS2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GLIS2
Ідентифікатори
Символи Kruppel-like zinc finger protein GLIS2neuronal Krueppel-like proteinnephrocystin-7zinc finger protein GLIS2GLI-similar 2GLIS2
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

GLIS2 (англ. GLIS family zinc finger 2) – білок, який кодується однойменним геном, розташованим у людей на 16-ї хромосомі.[1] Довжина поліпептидного ланцюга білка становить 524 амінокислот, а молекулярна маса — 55 689[2].

Послідовність амінокислот
1020304050
MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPG
SPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSP
ERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFL
TPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDA
GYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENL
KIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC
HKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSG
AQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGP
GLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGS
VPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASS
PEALAPGWVVIPPGSVLLKPAVVN

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Zhang F., Jetten A.M. (2001). Genomic structure of the gene encoding the human GLI-related, Kruppel-like zinc finger protein GLIS2.. Gene 280: 49 — 57.  PubMed DOI:10.1016/S0378-1119(01)00764-8
  • Kim Y.-S., Kang H.S., Jetten A.M. (2007). The Kruppel-like zinc finger protein Glis2 functions as a negative modulator of the Wnt/beta-catenin signaling pathway.. FEBS Lett. 581: 858 — 864.  PubMed DOI:10.1016/j.febslet.2007.01.058
  • Lamar E., Kintner C., Goulding M. (2001). Identification of NKL, a novel Gli-Kruppel zinc-finger protein that promotes neuronal differentiation.. Development 128: 1335 — 1346.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:29450 (англ.). Процитовано 21 вересня 2017. 
  2. UniProt, Q9BZE0 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]