ID1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ID1
Ідентифікатори
Символи ID1, ID, bHLHb24, inhibitor of DNA binding 1, HLH protein
Зовнішні ІД OMIM: 600349 MGI: 96396 HomoloGene: 1631 GeneCards: ID1
Шаблон експресії
PBB GE ID1 208937 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181353
NM_002165
NM_010495
NM_001355113
NM_001369018
RefSeq (білок)
NP_002156
NP_851998
NP_034625
NP_001342042
NP_001355947
Локус (UCSC) Хр. 20: 31.61 – 31.61 Mb Хр. 2: 152.74 – 152.74 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ID1 (англ. Inhibitor of DNA binding 1, HLH protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 155 амінокислот, а молекулярна маса — 16 133[4].

Послідовність амінокислот
1020304050
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAG
ARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVID
YIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADD
RILCR

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Deed R.W., Jasiok M., Norton J.D. (1994). Nucleotide sequence of the cDNA encoding human helix-loop-helix Id-1 protein: identification of functionally conserved residues common to Id proteins.. Biochim. Biophys. Acta 1219: 160 — 162.  PubMed DOI:10.1016/0167-4781(94)90261-5
  • Nehlin J.O., Hara E., Kuo W.L., Collins C., Campisi J. (1997). Genomic organization, sequence, and chromosomal localization of the human helix-loop-helix Id1 gene.. Biochem. Biophys. Res. Commun. 231: 628 — 634.  PubMed DOI:10.1006/bbrc.1997.6152
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ward S.M., Fernando S.J., Hou T.Y., Duffield G.E. (2010). The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.. J. Biol. Chem. 285: 38987 — 39000.  PubMed DOI:10.1074/jbc.M110.175182

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5360 (англ.). Архів оригіналу за 25 вересня 2015. Процитовано 12 вересня 2017. 
  4. UniProt, P41134 (англ.). Архів оригіналу за 27 вересня 2017. Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]