ZBTB7A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB7A
Protein ZBTB7A PDB 2if5.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZBTB7A, FBI-1, FBI1, LRF, ZBTB7, ZNF857A, pokemon, TIP21, zinc finger and BTB domain containing 7A
Зовнішні ІД OMIM: 605878 MGI: 1335091 HomoloGene: 7820 GeneCards: ZBTB7A
Шаблон експресії
PBB GE ZBTB7A 219186 at fs.png

PBB GE ZBTB7A 213303 x at fs.png

PBB GE ZBTB7A 213299 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015898
NM_001317990
NM_010731
RefSeq (білок)
NP_001304919
NP_056982
NP_034861
Локус (UCSC) Хр. 19: 4.04 – 4.07 Mb Хр. 10: 81.14 – 81.15 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB7A (англ. Zinc finger and BTB domain containing 7A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 584 амінокислот, а молекулярна маса — 61 439[4].

Послідовність амінокислот
1020304050
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRS
VLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVS
TANVGDILSAARLLEIPAVSHVCADLLDRQILAADAGADAGQLDLVDQID
QRNLLRAKEYLEFFQSNPMNSLPPAAAAAAASFPWSAFGASDDDLDATKE
AVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSNPGLWPERDED
APTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA
AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMD
YYLKYFSGAHDGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRH
IRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHN
YDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRK
PRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASP
DGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Schubot F.D., Tropea J.E., Waugh D.S. (2006). Structure of the POZ domain of human LRF, a master regulator of oncogenesis.. Biochem. Biophys. Res. Commun. 351: 1 — 6.  PubMed DOI:10.1016/j.bbrc.2006.09.167
  • Stogios P.J., Chen L., Prive G.G. (2007). Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator.. Protein Sci. 16: 336 — 342.  PubMed DOI:10.1110/ps.062660907

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18078 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O95365 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]