IRF4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IRF4
Protein IRF4 PDB 2dll.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IRF4, LSIRF, MUM1, NF-EM5, SHEP8, interferon regulatory factor 4
Зовнішні ІД OMIM: 601900 MGI: 1096873 HomoloGene: 1842 GeneCards: IRF4
Пов'язані генетичні захворювання
хронічний лімфолейкоз, skin carcinoma, progressive supranuclear palsy[1]
Шаблон експресії
PBB GE IRF4 216986 s at fs.png

PBB GE IRF4 216987 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001195286
NM_002460
NM_013674
NM_001347508
RefSeq (білок)
NP_001182215
NP_002451
NP_001334437
NP_038702
Локус (UCSC) Хр. 6: 0.39 – 0.41 Mb Хр. 13: 30.75 – 30.77 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IRF4 (англ. Interferon regulatory factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 451 амінокислот, а молекулярна маса — 51 772[5].

Послідовність амінокислот
1020304050
MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF
RIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCA
LNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSH
PYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGP
RGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDC
RLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL
ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKL
ITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQ
E

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rao S., Matsumura A., Yoon J., Simon M.C. (1999). SPI-B activates transcription via a unique proline, serine, and threonine domain and exhibits DNA binding affinity differences from PU.1.. J. Biol. Chem. 274: 11115 — 11124.  PubMed DOI:10.1074/jbc.274.16.11115

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]