NR1D2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR1D2
Rev-ErbA beta.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1D2, BD73, EAR-1R, RVR, nuclear receptor subfamily 1 group D member 2, REVERBB, REVERBbeta
Зовнішні ІД OMIM: 602304 MGI: 2449205 HomoloGene: 3763 GeneCards: NR1D2
Реагує на сполуку
sr-9009, sr-9011[1]
Шаблон експресії
PBB GE NR1D2 209750 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001145425
NM_005126
NM_011584
RefSeq (білок)
NP_001138897
NP_005117
NP_035714
Локус (UCSC) Хр. 3: 23.95 – 23.98 Mb Хр. 14: 18.2 – 18.24 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1D2 (англ. Nuclear receptor subfamily 1 group D member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 579 амінокислот, а молекулярна маса — 64 625[5].

Послідовність амінокислот
1020304050
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSD
TNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMV
LLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMR
MNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMN
SQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAK
EEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPLSKSPYVDPHKSGHE
IWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRF
ASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSD
EEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASI
FTKLLLKLPDLRSLNNMHSEELLAFKVHP

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, біологічні ритми, поліморфізм, ацетиляція. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза, ДНК, гемом. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gupta N., Ragsdale S.W. (2011). Thiol-disulfide redox dependence of heme binding and heme ligand switching in nuclear hormone receptor rev-erb{beta}.. J. Biol. Chem. 286: 4392 — 4403.  PubMed DOI:10.1074/jbc.M110.193466
  • Stratmann M., Schibler U. (2012). REV-ERBs: more than the sum of the individual parts.. Cell Metab. 15: 791 — 793.  PubMed DOI:10.1016/j.cmet.2012.05.006
  • Ripperger J.A., Albrecht U. (2012). REV-ERB-erating nuclear receptor functions in circadian metabolism and physiology.. Cell Res. 22: 1319 — 1321.  PubMed DOI:10.1038/cr.2012.81

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]