PHF6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHF6
4nn2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PHF6, BFLS, BORJ, CENP-31, PHD finger protein 6
Зовнішні ІД OMIM: 300414 MGI: 1918248 HomoloGene: 12375 GeneCards: PHF6
Пов'язані генетичні захворювання
Borjeson-Forssman-Lehmann syndrome[1]
Шаблон експресії
PBB GE PHF6 gnf1h00721 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032458
NM_001015877
NM_032335
NM_001290546
NM_027642
RefSeq (білок)
NP_001015877
NP_115711
NP_115834
NP_001277475
NP_081918
Локус (UCSC) Хр. X: 134.37 – 134.43 Mb Хр. X: 52.91 – 52.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHF6 (англ. PHD finger protein 6) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[4] Довжина поліпептидного ланцюга білка становить 365 амінокислот, а молекулярна маса — 41 290[5].

Послідовність амінокислот
1020304050
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSS
ALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCH
RTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHE
LEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSP
HRSSPSDTRPKCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTV
QLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKT
YHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKV
EIDQQQLTQQQLNGN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі, хромосомах, центромерах, кінетохорі.

Література[ред. | ред. код]

  • Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. (2001). Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 8: 85 — 95.  PubMed DOI:10.1093/dnares/8.2.85
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]