MTA2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MTA2
Ідентифікатори
Символи MTA2, MTA1L1, PID, metastasis associated 1 family member 2
Зовнішні ІД OMIM: 603947 MGI: 1346340 HomoloGene: 3480 GeneCards: MTA2
Шаблон експресії
PBB GE MTA2 203443 at fs.png

PBB GE MTA2 203444 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004739
NM_001330292
NM_011842
RefSeq (білок)
NP_001317221
NP_004730
NP_035972
Локус (UCSC) Хр. 11: 62.59 – 62.6 Mb Хр. 19: 8.94 – 8.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MTA2 (англ. Metastasis associated 1 family member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 668 амінокислот, а молекулярна маса — 75 023[4].

Послідовність амінокислот
1020304050
MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRD
ISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPAT
HIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVG
CKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAV
GTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMS
TLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV
GSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKK
YGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKN
RQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLP
KAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQN
RGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVP
LPAPSHPASTNEPIVLED

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Luo J., Su F., Chen D., Shiloh A., Gu W. (2000). Deacetylation of p53 modulates its effect on cell growth and apoptosis.. Nature 408: 377 — 381.  PubMed DOI:10.1038/35042612
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cong L., Pakala S.B., Ohshiro K., Li D.Q., Kumar R. (2011). SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.. J. Biol. Chem. 286: 43793 — 43808.  PubMed DOI:10.1074/jbc.M111.267237

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7411 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, O94776 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]