ETV4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ETV4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ETV4, E1A-F, E1AF, PEA3, PEAS3, ETS variant 4, ETS variant transcription factor 4
Зовнішні ІД OMIM: 600711 MGI: 99423 HomoloGene: 1504 GeneCards: ETV4
Шаблон експресії
PBB GE ETV4 211603 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008815
NM_001316365
NM_001316366
RefSeq (білок)
NP_001303294
NP_001303295
NP_032841
Локус (UCSC) Хр. 17: 43.53 – 43.58 Mb Хр. 11: 101.77 – 101.79 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ETV4 (англ. ETS variant 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 484 амінокислот, а молекулярна маса — 53 938[4].

Послідовність амінокислот
1020304050
MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDS
EDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQ
SPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSP
LQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGG
GREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGH
RYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVAL
LDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLR
YYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSE
EDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Coutte L., Monte D., Baert J.-L., de Launoit Y. (1999). Genomic organization of the human e1af gene, a member of Ets transcription factors.. Gene 240: 201 — 207.  PubMed DOI:10.1016/S0378-1119(99)00400-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Higashino F., Yoshida K., Fujinaga K., Kamio K., Fujinaga K. (1993). Isolation of a cDNA encoding the adenovirus E1A enhancer binding protein: a new human member of the ets oncogene family.. Nucleic Acids Res. 21: 547 — 553.  PubMed DOI:10.1093/nar/21.3.547
  • Guo B., Sharrocks A.D. (2009). Extracellular signal-regulated kinase mitogen-activated protein kinase signaling initiates a dynamic interplay between sumoylation and ubiquitination to regulate the activity of the transcriptional activator PEA3.. Mol. Cell. Biol. 29: 3204 — 3218.  PubMed DOI:10.1128/MCB.01128-08

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3493 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P43268 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]