THRA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
THRA
Protein THRA PDB 1nav.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи THRA, AR7, CHNG6, EAR7, ERB-T-1, ERBA, ERBA1, NR1A1, THRA1, THRA2, c-ERBA-1, thyroid hormone receptor, alpha, thyroid hormone receptor alpha
Зовнішні ІД OMIM: 190120 MGI: 98742 HomoloGene: 37747 GeneCards: THRA
Пов'язані генетичні захворювання
congenital nongoitrous hypothryoidism 6[1]
Реагує на сполуку
DL-3,3',5'-triiodothyronine, tiratricol, Трийодтиронін, Левотироксин[2]
Шаблон експресії
PBB GE THRA 35846 at fs.png

PBB GE THRA 204100 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_199334
NM_001190918
NM_001190919
NM_003250
NM_178060
NM_001313983
RefSeq (білок)
NP_001177847
NP_001177848
NP_003241
NP_955366
NP_001300912
NP_835161
Локус (UCSC) Хр. 17: 40.06 – 40.09 Mb Хр. 11: 98.74 – 98.77 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

THRA (англ. Thyroid hormone receptor, alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 490 амінокислот, а молекулярна маса — 54 816[6].

Послідовність амінокислот
1020304050
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKD
EQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVID
KITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEM
IRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSP
IVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIIL
LKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFE
HYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQ
QLLGMHVVQGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRS
GILHARAVCGEDDSSEADSPSSSEEEPEVCEDLAGNAASP

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Pfahl M., Benbrook D. (1987). Nucleotide sequence of cDNA encoding a novel human thyroid hormone receptor.. Nucleic Acids Res. 15: 9613 — 9613.  PubMed DOI:10.1093/nar/15.22.9613
  • Nakai A., Sakurai A., Bell G.I., Degroot L.J. (1988). Characterization of a third human thyroid hormone receptor coexpressed with other thyroid hormone receptors in several tissues.. Mol. Endocrinol. 2: 1087 — 1092.  PubMed DOI:10.1210/mend-2-11-1087
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Benbrook D., Pfahl M. (1987). A novel thyroid hormone receptor encoded by a cDNA clone from a human testis library.. Science 238: 788 — 791.  PubMed DOI:10.1126/science.3672126
  • Yang Y.Z., Burgos-Trinidad M., Wu Y., Koenig R.J. (1996). Thyroid hormone receptor variant alpha2. Role of the ninth heptad in dna binding, heterodimerization with retinoid X receptors, and dominant negative activity.. J. Biol. Chem. 271: 28235 — 28242.  PubMed DOI:10.1074/jbc.271.45.28235

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]