ATF6B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF6B
Ідентифікатори
Символи ATF6B, CREB-RP, CREBL1, G13, activating transcription factor 6 beta
Зовнішні ІД OMIM: 600984 MGI: 105121 HomoloGene: 31238 GeneCards: ATF6B
Шаблон експресії
PBB GE CREBL1 211611 s at fs.png

PBB GE CREBL1 216208 s at fs.png

PBB GE CREBL1 203168 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004381
NM_001136153
NM_017406
RefSeq (білок)
NP_001129625
NP_004372
н/д
Локус (UCSC) Хр. 6: 32.12 – 32.13 Mb Хр. 17: 34.65 – 34.66 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF6B (англ. Activating transcription factor 6 beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 703 амінокислот, а молекулярна маса — 76 709[4].

Послідовність амінокислот
1020304050
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFR
CPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSL
SSESSRLSTEPSSEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQIN
VIPTSDDSSDVQTKIEPVSPCSSVNSEASLLSADSSSQAFIGEEVLEVKT
ESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTRKPPLQPKPVV
LTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYL
QGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCI
MVFLLFIAFNFGPVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQG
VEPLQGSSQGPKEPQPSPTDQPSFSNLTAFPGGAKELLLRDLDQLFLSSD
CRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVK
AVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVM
DTRVIHIKTSTVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYL
NHP

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, відповідь на порушення конформації білку, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Khanna A., Campbell R.D. (1996). The gene G13 in the class III region of the human MHC encodes a potential DNA-binding protein.. Biochem. J. 319: 81 — 89.  PubMed DOI:10.1042/bj3190081
  • Speek M., Barry F., Miller W.L. (1996). Alternate promoters and alternate splicing of human tenascin-X, a gene with 5' and 3' ends buried in other genes.. Hum. Mol. Genet. 5: 1749 — 1758.  PubMed DOI:10.1093/hmg/5.11.1749

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2349 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q99941 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]