PAX5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PAX5
Protein PAX5 PDB 1k78.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PAX5, ALL3, BSAP, paired box 5
Зовнішні ІД OMIM: 167414 MGI: 97489 HomoloGene: 56419 GeneCards: PAX5
Пов'язані генетичні захворювання
Артеріальна гіпертензія, Ожиріння[1]
Шаблон експресії
PBB GE PAX5 206802 at fs.png

PBB GE PAX5 221969 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008782
RefSeq (білок)
NP_032808
Локус (UCSC) Хр. 9: 36.83 – 37.03 Mb Хр. 4: 44.52 – 44.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PAX5 (англ. Paired box 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 391 амінокислот, а молекулярна маса — 42 149[5].

Послідовність амінокислот
1020304050
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVR
PCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIA
EYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQP
VPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRD
EGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIF
TTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQ
YSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез, сперматогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Robichaud G.A., Nardini M., Laflamme M., Cuperlovic-Culf M., Ouellette R.J. (2004). Human Pax-5 C-terminal isoforms possess distinct transactivation properties and are differentially modulated in normal and malignant B cells.. J. Biol. Chem. 279: 49956 — 49963.  PubMed DOI:10.1074/jbc.M407171200
  • Arseneau J.R., Laflamme M., Lewis S.M., Maicas E., Ouellette R.J. (2009). Multiple isoforms of PAX5 are expressed in both lymphomas and normal B-cells.. Br. J. Haematol. 147: 328 — 338.  PubMed DOI:10.1111/j.1365-2141.2009.07859.x
  • Verkoczy L.K., Berinstein N.L. (1998). Isolation of genes negatively or positively co-expressed with human recombination activating gene 1 (RAG1) by differential display PCR (DD RT-PCR).. Nucleic Acids Res. 26: 4497 — 4507.  PubMed DOI:10.1093/nar/26.19.4497
  • Eberhard D., Jimenez G., Heavey B., Busslinger M. (2000). Transcriptional repression by Pax5 (BSAP) through interaction with corepressors of the Groucho family.. EMBO J. 19: 2292 — 2303.  PubMed DOI:10.1093/emboj/19.10.2292
  • Garvie C.W., Hagman J., Wolberger C. (2001). Structural studies of Ets-1/Pax5 complex formation on DNA.. Mol. Cell 8: 1267 — 1276.  PubMed DOI:10.1016/S1097-2765(01)00410-5

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]