TEAD2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TEAD2
PDB 2hzd EBI.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TEAD2, ETF, TEAD-2, TEF-4, TEF4, TEA domain transcription factor 2
Зовнішні ІД OMIM: 601729 MGI: 104904 HomoloGene: 19662 GeneCards: TEAD2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001285498
NM_001285500
NM_011565
RefSeq (білок)
NP_001272427
NP_001272429
NP_035695
Локус (UCSC) Хр. 19: 49.34 – 49.36 Mb Хр. 7: 45.22 – 45.23 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TEAD2 (англ. TEA domain transcription factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 447 амінокислот, а молекулярна маса — 49 243[4].

Послідовність амінокислот
1020304050
MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIE
QSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQV
SSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKL
GPTGPQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYE
PPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHL
FVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV
KFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSF
GKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMN
SVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRD

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jacquemin P., Hwang J.-J., Martial J.A., Dolle P., Davidson I. (1996). A novel family of developmentally regulated mammalian transcription factors containing the TEA/ATTS DNA binding domain.. J. Biol. Chem. 271: 21775 — 21785.  PubMed DOI:10.1074/jbc.271.36.21775

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11715 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q15562 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]