ZBTB11

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB11
Ідентифікатори
Символи ZBTB11, ZNF-U69274, ZNF913, zinc finger and BTB domain containing 11, MRT69
Зовнішні ІД OMIM: 618181 MGI: 2443876 HomoloGene: 8678 GeneCards: ZBTB11
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014415
NM_173026
RefSeq (білок)
NP_055230
NP_766614
Локус (UCSC) Хр. 3: 101.65 – 101.68 Mb Хр. 16: 55.97 – 56.01 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB11 (англ. Zinc finger and BTB domain containing 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 053 амінокислот, а молекулярна маса — 119 384[4].

Послідовність амінокислот
1020304050
MSSEESYRAILRYLTNEREPYAPGTEGNVKRKIRKAAACYVVRGGTLYYQ
RRQRHRKTFAELEVVLQPERRRDLIEAAHLGPGGTHHTRHQTWHYLSKTY
WWRGILKQVKDYIKQCSKCQEKLDRSRPISDVSEMLEELGLDLESGEESN
ESEDDLSNFTSSPTTASKPAKKKPVSKHELVFVDTKGVVKRSSPKHCQAV
LKQLNEQRLSNQFCDVTLLIEGEEYKAHKSVLSANSEYFRDLFIEKGAVS
SHEAVVDLSGFCKASFLPLLEFAYTSVLSFDFCSMADVAILARHLFMSEV
LEICESVHKLMEEKQLTVYKKGEVQTVASTQDLRVQNGGTAPPVASSEGT
TTSLPTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVG
CIADSHPEMESVDLITKNNQTELETSNNRENNTVSNIHPKLSKENVISSS
PEDSGMGNDISAEDICAEDIPKHRQKVDQPLKDQENLVASTAKTDFGPDD
DTYRSRLRQRSVNEGAYIRLHKGMEKKLQKRKAVPKSAVQQVAQKLVQRG
KKMKQPKRDAKENTEEASHKCGECGMVFQRRYALIMHKLKHERARDYKCP
LCKKQFQYSASLRAHLIRHTRKDAPSSSSSNSTSNEASGTSSEKGRTKRE
FICSICGRTLPKLYSLRIHMLKHTGVKPHACQVCGKTFIYKHGLKLHQSL
HQSQKQFQCELCVKSFVTKRSLQEHMSIHTGESKYLCSVCGKSFHRGSGL
SKHFKKHQPKPEVRGYHCTQCEKSFFEARDLRQHMNKHLGVKPFQCQFCD
KCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRHVKKATHGKKG
RAKQNLERVCEKCGRKFTQLREYRRHMNNHEGVKPFECLTCGVAWADARS
LKRHVRTHTGERPYVCPVCSEAYIDARTLRKHMTKFHRDYVPCKIMLEKD
TLQFHNQGTQVAHAVSILTAGMQEQESSGPQELETVVVTGETMEALEAVA
ATEEYPSVSTLSDQSIMQVVNYVLAQQQGQKLSEVAEAIQTVKVEVAHIS
GGE

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16740 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, O95625 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]