ING2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ING2
Protein ING2 PDB 1wes.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ING2, ING1L, p33inhibitor of growth family member 2
Зовнішні ІД OMIM: 604215 MGI: 1916510 HomoloGene: 20388 GeneCards: ING2
Шаблон експресії
PBB GE ING2 205981 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001291959
NM_001564
NM_023503
RefSeq (білок)
NP_001278888
NP_001555
NP_075992
Локус (UCSC) Хр. 4: 183.51 – 183.51 Mb Хр. 8: 47.67 – 47.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ING2 (англ. Inhibitor of growth family member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 280 амінокислот, а молекулярна маса — 32 808[4].

Послідовність амінокислот
1020304050
MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLR
ELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEK
IQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSR
RPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREA
SPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPK
GKWYCPKCRGDNEKTMDKSTEKTKKDRRSR

Кодований геном білок за функцією належить до регуляторів хроматину. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, регуляція росту, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kuzmichev A., Zhang Y., Erdjument-Bromage H., Tempst P., Reinberg D. (2002). Role of the Sin3-histone deacetylase complex in growth regulation by the candidate tumor suppressor p33(ING1).. Mol. Cell. Biol. 22: 835 — 848.  PubMed DOI:10.1128/MCB.22.3.835-848.2002
  • Kaadige M.R., Ayer D.E. (2006). The polybasic region that follows the plant homeodomain zinc finger 1 of Pf1 is necessary and sufficient for specific phosphoinositide binding.. J. Biol. Chem. 281: 28831 — 28836.  PubMed DOI:10.1074/jbc.M605624200
  • Shimada Y., Saito A., Suzuki M., Takahashi E., Horie M. (1998). Cloning of a novel gene (ING1L) homologous to ING1, a candidate tumor suppressor.. Cytogenet. Cell Genet. 83: 232 — 235.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6063 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9H160 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]