MEIS2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MEIS2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MEIS2, HsT18361, MRG1, Meis homeobox 2, CPCMR
Зовнішні ІД OMIM: 601740 MGI: 108564 HomoloGene: 7846 GeneCards: MEIS2
Шаблон експресії
PBB GE MEIS2 207480 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 15: 36.89 – 37.1 Mb Хр. 2: 115.86 – 116.07 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MEIS2 (англ. Meis homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 477 амінокислот, а молекулярна маса — 51 790[4].

Послідовність амінокислот
1020304050
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQH
YGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELAT
CTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQA
IQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDH
EELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSE
QGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLT
HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLD
PSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGM
SMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGM
TMSAQSPTMLNSVDPNVGGQVMDIHAQ

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Smith J.E. Jr., Afonja O., Yee H.T., Inghirami G., Takeshita K. (1997). Chromosomal mapping to 15q14 and expression analysis of the human MEIS2 homeobox gene.. Mamm. Genome 8: 951 — 952.  PubMed DOI:10.1007/s003359900621
  • Liu Y., MacDonald R.J., Swift G.H. (2001). DNA binding and transcriptional activation by a PDX1.PBX1b.MEIS2b trimer and cooperation with a pancreas-specific basic helix-loop-helix complex.. J. Biol. Chem. 276: 17985 — 17993.  PubMed DOI:10.1074/jbc.M100678200
  • Hyman-Walsh C., Bjerke G.A., Wotton D. (2010). An autoinhibitory effect of the homothorax domain of Meis2.. FEBS J. 277: 2584 — 2597.  PubMed DOI:10.1111/j.1742-4658.2010.07668.x
  • Bjerke G.A., Hyman-Walsh C., Wotton D. (2011). Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.. Mol. Cell. Biol. 31: 3723 — 3733.  PubMed DOI:10.1128/MCB.01456-10

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7001 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, O14770 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]