ZNF7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF7
Ідентифікатори
Символи ZNF7, HF.16, KOX4, zf30, zinc finger protein 7
Зовнішні ІД OMIM: 194531 MGI: 99208 HomoloGene: 20729 GeneCards: ZNF7
Шаблон експресії
PBB GE ZNF7 205089 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_145916
NM_001358816
NM_001358817
NM_001358818
RefSeq (білок)
NP_666021
NP_001345745
NP_001345746
NP_001345747
Локус (UCSC) Хр. 8: 144.83 – 144.85 Mb Хр. 15: 76.88 – 76.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF7 (англ. Zinc finger protein 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 686 амінокислот, а молекулярна маса — 77 887[4].

Послідовність амінокислот
1020304050
MEVVTFGDVAVHFSREEWQCLDPGQRALYREVMLENHSSVAGLAGFLVFK
PELISRLEQGEEPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDIL
KSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQN
NCLNEETVVPKTFTKDAPQGCKELGSSGLDCQPLESQGESAEGMSQRCEE
CGKGIRATSDIALHWEINTQKISRCQECQKKLSDCLQGKHTNNCHGEKPY
ECAECGKVFRLCSQLNQHQRIHTGEKPFKCTECGKAFRLSSKLIQHQRIH
TGEKPYRCEECGKAFGQSSSLIHHQRIHTGERPYGCRECGKAFSQQSQLV
RHQRTHTGERPYPCKECGKAFSQSSTLAQHQRMHTGEKAQILKASDSPSL
VAHQRIHAVEKPFKCDECGKAFRWISRLSQHQLIHTGEKPYKCNKCTKAF
GCSSRLIRHQRTHTGEKPFKCDECGKGFVQGSHLIQHQRIHTGEKPYVCN
DCGKAFSQSSSLIYHQRIHKGEKPYECLQCGKAFSMSTQLTIHQRVHTGE
RPYKCNECGKAFSQNSTLFQHQIIHAGVKPYECSECGKAFSRSSYLIEHQ
RIHTRAQWFYEYGNALEGSTFVSRKKVNTIKKLHQCEDCEKIFRWRSHLI
IHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13139 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P17097 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]