E2F4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
E2F4
Protein E2F4 PDB 1cf7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи E2F4, E2F-4, E2F transcription factor 4
Зовнішні ІД OMIM: 600659 MGI: 103012 HomoloGene: 1471 GeneCards: E2F4
Шаблон експресії
PBB GE E2F4 202248 at fs.png

PBB GE E2F4 38707 r at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001950
NM_148952
RefSeq (білок)
NP_001941
NP_683754
Локус (UCSC) Хр. 16: 67.19 – 67.2 Mb Хр. 8: 105.3 – 105.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

E2F4 (англ. E2F transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 413 амінокислот, а молекулярна маса — 43 960[4].

Послідовність амінокислот
1020304050
MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTL
AVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIEL
KAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHEDICRCFA
GDTLLAIRAPSGTSLEVPIPEGLNGQKKYQIHLKSVSGPIEVLLVNKEAW
SSPPVAVPVPPPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPT
AVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ
SSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPK
ELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESE
GVCDLFDVPVLNL

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, біогенез та деградація війок, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Schwemmle S., Pfeifer G.P. (2000). Genomic structure and mutation screening of the E2F4 gene in human tumors.. Int. J. Cancer 86: 672 — 677.  PubMed DOI:10.1002/(SICI)1097-0215(20000601)86:5<672::AID-IJC11>3.0.CO;2-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Williams C.D., Linch D.C., Soerensen T.S., La Thangue N.B., Thomas N.S.B. (1997). The predominant E2F complex in human primary haemopoietic cells and in AML blasts contains E2F-4, DP-1 and p130.. Br. J. Haematol. 96: 688 — 696.  PubMed DOI:10.1046/j.1365-2141.1997.d01-2086.x
  • Lang S.E., McMahon S.B., Cole M.D., Hearing P. (2001). E2F transcriptional activation requires TRRAP and GCN5 cofactors.. J. Biol. Chem. 276: 32627 — 32634.  PubMed DOI:10.1074/jbc.M102067200
  • Luciano R.L., Wilson A.C. (2003). HCF-1 functions as a coactivator for the zinc finger protein Krox20.. J. Biol. Chem. 278: 51116 — 51124.  PubMed DOI:10.1074/jbc.M303470200
  • Wang G.L., Iakova P., Wilde M., Awad S., Timchenko N.A. (2004). Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity.. Genes Dev. 18: 912 — 925.  PubMed DOI:10.1101/gad.1183304

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3118 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q16254 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]