SIX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SIX3
Ідентифікатори
Символи SIX3, HPE2, SIX homeobox 3
Зовнішні ІД OMIM: 603714 MGI: 102764 HomoloGene: 3947 GeneCards: SIX3
Пов'язані генетичні захворювання
holoprosencephaly 2, schizencephaly[1]
Шаблон експресії
PBB GE SIX3 206634 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005413
NM_011381
RefSeq (білок)
NP_005404
NP_035511
Локус (UCSC) Хр. 2: 44.94 – 44.95 Mb Хр. 17: 85.61 – 85.63 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SIX3 (англ. SIX homeobox 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 332 амінокислот, а молекулярна маса — 35 487[5].

Послідовність амінокислот
1020304050
MVFRSPLDLYSSHFLLPNFADSHHRSILLASSGGGNGAGGGGGAGGGSGG
GNGAGGGGAGGAGGGGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLE
ETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYH
ILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLP
RTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQV
GNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTA
ASPTTSVSSLTERADTGTSILSVTSSDSECDV

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Leppert G.S., Yang J.-M., Sundin O.H. (1999). Sequence and location of SIX3, a homeobox gene expressed in the human eye.. Ophthalmic Genet. 20: 7 — 21.  PubMed DOI:10.1076/opge.20.1.7.2298
  • Lopez-Rios J., Tessmar K., Loosli F., Wittbrodt J., Bovolenta P. (2003). Six3 and Six6 activity is modulated by members of the groucho family.. Development 130: 185 — 195.  PubMed DOI:10.1242/dev.00185
  • Laflamme C., Filion C., Labelle Y. (2004). Functional characterization of SIX3 homeodomain mutations in holoprosencephaly: interaction with the nuclear receptor NR4A3/NOR1.. Hum. Mutat. 24: 502 — 508.  PubMed DOI:10.1002/humu.20102
  • Del Bene F., Tessmar-Raible K., Wittbrodt J. (2004). Direct interaction of geminin and Six3 in eye development.. Nature 427: 745 — 749.  PubMed DOI:10.1038/nature02292
  • Ribeiro L.A., El-Jaick K.B., Muenke M., Richieri-Costa A. (2006). SIX3 mutations with holoprosencephaly.. Am. J. Med. Genet. A 140: 2577 — 2583.  PubMed DOI:10.1002/ajmg.a.31377

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]