PHF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHF3
Protein PHF3 PDB 2dme.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи PHF3, PHD finger protein 3
Зовнішні ІД OMIM: 607789 MGI: 2446126 HomoloGene: 9040 GeneCards: PHF3
Шаблон експресії
PBB GE PHF3 217952 x at fs.png

PBB GE PHF3 215718 s at fs.png

PBB GE PHF3 217951 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001081080
NM_025871
RefSeq (білок)
н/д
Локус (UCSC) Хр. 6: 63.64 – 63.78 Mb Хр. 1: 30.8 – 30.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHF3 (англ. PHD finger protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 039 амінокислот, а молекулярна маса — 229 481[4].

Послідовність амінокислот
1020304050
MDIVDTFNHLIPTEHLDDALFLGSNLENEVCEDFSASQNVLEDSLKNMLS
DKDPMLGSASNQFCLPVLDSNDPNFQMPCSTVVGLDDIMDEGVVKESGND
TIDEEELILPNRNLRDKVEENSVRSPRKSPRLMAQEQVRSLRQSTIAKRS
NAAPLSNTKKASGKTVSTAKAGVKQPERSQVKEEVCMSLKPEYHKENRRC
SRNSGQIEVVPEVSVSSSHSSVSSCLEMKDEDGLDSKHKCNNPGEIDVPS
HELNCSLLSETCVTIGEKKNEALMECKAKPVGSPLFKFSDKEEHEQNDSI
SGKTGETVVEEMIATRKVEQDSKETVKLSHEDDHILEDAGSSDISSDAAC
TNPNKTENSLVGLPSCVDEVTECNLELKDTMGIADKTENTLERNKIEPLG
YCEDAESNRQLESTEFNKSNLEVVDTSTFGPESNILENAICDVPDQNSKQ
LNAIESTKIESHETANLQDDRNSQSSSVSYLESKSVKSKHTKPVIHSKQN
MTTDAPKKIVAAKYEVIHSKTKVNVKSVKRNTDVPESQQNFHRPVKVRKK
QIDKEPKIQSCNSGVKSVKNQAHSVLKKTLQDQTLVQIFKPLTHSLSDKS
HAHPGCLKEPHHPAQTGHVSHSSQKQCHKPQQQAPAMKTNSHVKEELEHP
GVEHFKEEDKLKLKKPEKNLQPRQRRSSKSFSLDEPPLFIPDNIATIRRE
GSDHSSSFESKYMWTPSKQCGFCKKPHGNRFMVGCGRCDDWFHGDCVGLS
LSQAQQMGEEDKEYVCVKCCAEEDKKTEILDPDTLENQATVEFHSGDKTM
ECEKLGLSKHTTNDRTKYIDDTVKHKVKILKRESGEGRNSSDCRDNEIKK
WQLAPLRKMGQPVLPRRSSEEKSEKIPKESTTVTCTGEKASKPGTHEKQE
MKKKKVEKGVLNVHPAASASKPSADQIRQSVRHSLKDILMKRLTDSNLKV
PEEKAAKVATKIEKELFSFFRDTDAKYKNKYRSLMFNLKDPKNNILFKKV
LKGEVTPDHLIRMSPEELASKELAAWRRRENRHTIEMIEKEQREVERRPI
TKITHKGEIEIESDAPMKEQEAAMEIQEPAANKSLEKPEGSEKQKEEVDS
MSKDTTSQHRQHLFDLNCKICIGRMAPPVDDLSPKKVKVVVGVARKHSDN
EAESIADALSSTSNILASEFFEEEKQESPKSTFSPAPRPEMPGTVEVEST
FLARLNFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRIS
PQTVWDYVEKIKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGV
AANNMKQVKDMYLIPLGATDKIPHPLVPFDGPGLELHRPNLLLGLIIRQK
LKRQHSACASTSHIAETPESAPPIALPPDKKSKIEVSTEEAPEEENDFFN
SFTTVLHKQRNKPQQNLQEDLPTAVEPLMEVTKQEPPKPLRFLPGVLIGW
ENQPTTLELANKPLPVDDILQSLLGTTGQVYDQAQSVMEQNTVKEIPFLN
EQTNSKIEKTDNVEVTDGENKEIKVKVDNISESTDKSAEIETSVVGSSSI
SAGSLTSLSLRGKPPDVSTEAFLTNLSIQSKQEETVESKEKTLKRQLQED
QENNLQDNQTSNSSPCRSNVGKGNIDGNVSCSENLVANTARSPQFINLKR
DPRQAAGRSQPVTTSESKDGDSCRNGEKHMLPGLSHNKEHLTEQINVEEK
LCSAEKNSCVQQSDNLKVAQNSPSVENIQTSQAEQAKPLQEDILMQNIET
VHPFRRGSAVATSHFEVGNTCPSEFPSKSITFTSRSTSPRTSTNFSPMRP
QQPNLQHLKSSPPGFPFPGPPNFPPQSMFGFPPHLPPPLLPPPGFGFAQN
PMVPWPPVVHLPGQPQRMMGPLSQASRYIGPQNFYQVKDIRRPERRHSDP
WGRQDQQQLDRPFNRGKGDRQRFYSDSHHLKRERHEKEWEQESERHRRRD
RSQDKDRDRKSREEGHKDKERARLSHGDRGTDGKASRDSRNVDKKPDKPK
SEDYEKDKEREKSKHREGEKDRDRYHKDRDHTDRTKSKR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8921 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q92576 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]