ZNF22

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF22
Ідентифікатори
Символи ZNF22, HKR-T1, KOX15, ZNF422, Zfp422, zinc finger protein 22
Зовнішні ІД OMIM: 194529 MGI: 1914505 HomoloGene: 5067 GeneCards: ZNF22
Шаблон експресії
PBB GE ZNF22 218006 s at fs.png

PBB GE ZNF22 218005 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006963
NM_026057
NM_001302439
NM_001302440
RefSeq (білок)
NP_008894
NP_008894.2
NP_001289368
NP_001289369
NP_080333
Локус (UCSC) Хр. 10: 45 – 45.01 Mb Хр. 6: 116.62 – 116.63 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF22 (англ. Zinc finger protein 22) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 224 амінокислот, а молекулярна маса — 25 915[4].

Послідовність амінокислот
1020304050
MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSL
DDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQ
HRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQ
SSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGK
NIRVKTHLPSWKAGTGRKSVAGLR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Gao Y., Kobayashi H., Ganss B. (2003). The human KROX-26/ZNF22 gene is expressed at sites of tooth formation and maps to the locus for permanent tooth agenesis (He-Zhao deficiency).. J. Dent. Res. 82: 1002 — 1007.  PubMed DOI:10.1177/154405910308201213
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bray P.L., Lichter P., Thiesen H.-J., Ward D.C., Dawid I.B. (1991). Characterization and mapping of human genes encoding zinc finger proteins.. Proc. Natl. Acad. Sci. U.S.A. 88: 9563 — 9567.  PubMed DOI:10.1073/pnas.88.21.9563
  • Wu B.Y., Hanley E.W., Turka L.A., Nabel G.J. (1992). Isolation of a cDNA clone encoding a zinc finger protein highly expressed in T-leukemia lines.. Blood 80: 2571 — 2576.  PubMed
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13012 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P17026 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]