NFYA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFYA
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFYA, CBF-A, CBF-B, HAP2, NF-YA, nuclear transcription factor Y subunit alpha
Зовнішні ІД OMIM: 189903 MGI: 97316 HomoloGene: 32114 GeneCards: NFYA
Шаблон експресії
PBB GE NFYA 204107 at fs.png

PBB GE NFYA 204109 s at fs.png

PBB GE NFYA 204108 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021705
NM_002505
NM_001110832
NM_010913
NM_001347401
NM_001347402
RefSeq (білок)
NP_002496
NP_068351
NP_001104302
NP_001334330
NP_001334331
NP_035043
Локус (UCSC) Хр. 6: 41.07 – 41.1 Mb Хр. 17: 48.39 – 48.41 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFYA (англ. Nuclear transcription factor Y subunit alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 347 амінокислот, а молекулярна маса — 36 877[4].

Послідовність амінокислот
1020304050
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQ
TLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQG
LQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQ
QIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAG
AQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQ
RIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Becker D.M., Fikes J.D., Guarente L. (1991). A cDNA encoding a human CCAAT-binding protein cloned by functional complementation in yeast.. Proc. Natl. Acad. Sci. U.S.A. 88: 1968 — 1972.  PubMed DOI:10.1073/pnas.88.5.1968
  • Yamada K., Printz R.L., Osawa H., Granner D.K. (1999). Human ZHX1: cloning, chromosomal location, and interaction with transcription factor NF-Y.. Biochem. Biophys. Res. Commun. 261: 614 — 621.  PubMed DOI:10.1006/bbrc.1999.1087
  • Yamada K., Osawa H., Granner D.K. (1999). Identification of proteins that interact with NF-YA.. FEBS Lett. 460: 41 — 45.  PubMed DOI:10.1016/S0014-5793(99)01311-3
  • Lim K., Chang H.I. (2009). O-GlcNAcylation of Sp1 interrupts Sp1 interaction with NF-Y.. Biochem. Biophys. Res. Commun. 382: 593 — 597.  PubMed DOI:10.1016/j.bbrc.2009.03.075

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7804 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P23511 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]