POU4F2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
POU4F2
Ідентифікатори
Символи POU4F2, BRN3.2, BRN3B, Brn-3b, POU class 4 homeobox 2
Зовнішні ІД OMIM: 113725 MGI: 102524 HomoloGene: 20959 GeneCards: POU4F2
Шаблон експресії
PBB GE POU4F2 207725 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004575
NM_138944
RefSeq (білок)
NP_004566
NP_620394
Локус (UCSC) Хр. 4: 146.64 – 146.64 Mb Хр. 8: 78.43 – 78.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

POU4F2 (англ. POU class 4 homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 409 амінокислот, а молекулярна маса — 43 087[4].

Послідовність амінокислот
1020304050
MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS
SNAGGGGGGGGGGGGGGGRSSSSSSSGSSGGGGSEAMRRACLPTPPSNIF
GGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPDATYHTMNTIPC
TSAASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGL
ALGAMAGPDGAVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSD
VDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTIC
RFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRT
SIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQ
KRMKYSAGI

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, диференціація, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • Ring C.J.A., Latchman D.S. (1993). The human Brn-3b POU transcription factor shows only limited homology to the Brn-3a/RDC-1 factor outside the conserved POU domain.. Nucleic Acids Res. 21: 2946 — 2946.  PubMed DOI:10.1093/nar/21.12.2946
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Salichs E., Ledda A., Mularoni L., Alba M.M., de la Luna S. (2009). Genome-wide analysis of histidine repeats reveals their role in the localization of human proteins to the nuclear speckles compartment.. PLoS Genet. 5: E1000397 — E1000397.  PubMed DOI:10.1371/journal.pgen.1000397
  • Bhargava A.K., Li Z., Weissman S.M. (1993). Differential expression of four members of the POU family of proteins in activated and phorbol 12-myristate 13-acetate-treated Jurkat T cells.. Proc. Natl. Acad. Sci. U.S.A. 90: 10260 — 10264.  PubMed DOI:10.1073/pnas.90.21.10260
  • Dennis J.H., Budhram-Mahadeo V., Latchman D.S. (2001). The Brn-3b POU family transcription factor regulates the cellular growth, proliferation, and anchorage dependence of MCF7 human breast cancer cells.. Oncogene 20: 4961 — 4971.  PubMed DOI:10.1038/sj.onc.1204491

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9219 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q12837 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]