TAF4B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF4B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF4B, SPGF13, TAF2C2, TAFII105, TATA-box binding protein associated factor 4b
Зовнішні ІД OMIM: 601689 MGI: 2152345 HomoloGene: 28266 GeneCards: TAF4B
Шаблон експресії
PBB GE TAF4B gnf1h09648 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001293725
NM_005640
NM_001100449
NM_001369357
NM_001369358
RefSeq (білок)
NP_001280654
NP_005631
NP_001093919
NP_001356286
NP_001356287
Локус (UCSC) Хр. 18: 26.23 – 26.39 Mb Хр. 18: 14.78 – 14.9 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF4B (англ. TATA-box binding protein associated factor 4b) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 862 амінокислот, а молекулярна маса — 91 091[4].

Послідовність амінокислот
1020304050
MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTPVALGAVTKAPV
SVCVEPTASQPLRSPVGTLVTKVAPVSAPPKVSSGPRLPAPQIVAVKAPN
TTTIQFPANLQLPPGTVLIKSNSGPLMLVSPQQTVTRAETTSNITSRPAV
PANPQTVKICTVPNSSSQLIKKVAVTPVKKLAQIGTTVVTTVPKPSSVQS
VAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQIN
LSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSS
DMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLA
GPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSL
QPEKPVVSGTAVTLSLPAVTFGETSGAAICLPSVKPVVSSAGTTSDKPVI
GTPVQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNEKQVTTISHSS
TLTIQKCGQKTMPVNTIIPTSQFPPASILKQITLPGNKILSLQASPTQKN
RIKENVTSCFRDEDDINDVTSMAGVNLNEENACILATNSELVGTLIQSCK
DEPFLFIGALQKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLT
AIAQHRMTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLK
AAKSRSNKEDPEQLRLKQKAKELQQLELAQIQHRDANLTALAAIGPRKKR
PLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDLIFCMEQEREM
KYSRALYLALLK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, сперматогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Wu Y., Lu Y., Hu Y., Li R. (2005). Cyclic AMP-dependent modification of gonad-selective TAF(II)105 in a human ovarian granulosa cell line.. J. Cell. Biochem. 96: 751 — 759.  PubMed DOI:10.1002/jcb.20577
  • Dikstein R., Zhou S., Tjian R. (1996). Human TAFII 105 is a cell type-specific TFIID subunit related to hTAFII130.. Cell 87: 137 — 146.  PubMed DOI:10.1016/S0092-8674(00)81330-6
  • Wolstein O., Silkov A., Revach M., Dikstein R. (2000). Specific interaction of TAFII105 with OCA-B is involved in activation of octamer-dependent transcription.. J. Biol. Chem. 275: 16459 — 16465.  PubMed DOI:10.1074/jbc.275.22.16459
  • Yamit-Hezi A., Nir S., Wolstein O., Dikstein R. (2000). Interaction of TAFII105 with selected p65/RelA dimers is associated with activation of subset of NF-kappa B genes.. J. Biol. Chem. 275: 18180 — 18187.  PubMed DOI:10.1074/jbc.275.24.18180
  • Rashevsky-Finkel A., Silkov A., Dikstein R. (2001). A composite nuclear export signal in the TBP-associated factor TAFII105.. J. Biol. Chem. 276: 44963 — 44969.  PubMed DOI:10.1074/jbc.M106112200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11538 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q92750 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]